Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4269356..4269614 | Replicon | chromosome |
Accession | NZ_CP117235 | ||
Organism | Escherichia coli strain ATCC 25922 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | PQQ28_RS21015 | Protein ID | WP_000809168.1 |
Coordinates | 4269462..4269614 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 4269356..4269413 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ28_RS21000 | 4265185..4266444 | - | 1260 | WP_000494928.1 | hypothetical protein | - |
PQQ28_RS21005 | 4266573..4268066 | - | 1494 | WP_001443162.1 | sulfatase-like hydrolase/transferase | - |
PQQ28_RS21010 | 4268086..4268847 | - | 762 | WP_001274832.1 | outer membrane protein OmpK | - |
- | 4269356..4269413 | - | 58 | - | - | Antitoxin |
PQQ28_RS21015 | 4269462..4269614 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
PQQ28_RS21020 | 4269719..4270849 | - | 1131 | WP_001118465.1 | molecular chaperone DnaJ | - |
PQQ28_RS21025 | 4270938..4272854 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
PQQ28_RS21030 | 4273226..4273630 | + | 405 | WP_000843687.1 | DUF2541 family protein | - |
PQQ28_RS21035 | 4273656..4274369 | + | 714 | WP_001102391.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T270141 WP_000809168.1 NZ_CP117235:4269462-4269614 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT270141 NZ_CP117235:c4269413-4269356 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|