Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3092854..3093688 | Replicon | chromosome |
| Accession | NZ_CP117235 | ||
| Organism | Escherichia coli strain ATCC 25922 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | PQQ28_RS15475 | Protein ID | WP_000854690.1 |
| Coordinates | 3092854..3093231 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | PQQ28_RS15480 | Protein ID | WP_001546171.1 |
| Coordinates | 3093320..3093688 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ28_RS15440 (3088445) | 3088445..3088999 | - | 555 | WP_001001909.1 | molecular chaperone YcdY | - |
| PQQ28_RS15445 (3089023) | 3089023..3089760 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| PQQ28_RS15450 (3089815) | 3089815..3090753 | - | 939 | WP_000351287.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| PQQ28_RS15460 (3091224) | 3091224..3092067 | - | 844 | Protein_2962 | DUF4942 domain-containing protein | - |
| PQQ28_RS15465 (3092152) | 3092152..3092349 | - | 198 | WP_000772027.1 | DUF957 domain-containing protein | - |
| PQQ28_RS15470 (3092369) | 3092369..3092857 | - | 489 | WP_001546173.1 | DUF5983 family protein | - |
| PQQ28_RS15475 (3092854) | 3092854..3093231 | - | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| PQQ28_RS15480 (3093320) | 3093320..3093688 | - | 369 | WP_001546171.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PQQ28_RS15485 (3093738) | 3093738..3094382 | - | 645 | WP_000094915.1 | hypothetical protein | - |
| PQQ28_RS15490 (3094401) | 3094401..3094622 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| PQQ28_RS15495 (3094685) | 3094685..3095161 | - | 477 | WP_001537421.1 | RadC family protein | - |
| PQQ28_RS15500 (3095177) | 3095177..3095650 | - | 474 | WP_000855076.1 | antirestriction protein | - |
| PQQ28_RS15505 (3095913) | 3095913..3096734 | - | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
| PQQ28_RS15510 (3096913) | 3096913..3097002 | - | 90 | WP_230607454.1 | DUF905 family protein | - |
| PQQ28_RS15515 (3097145) | 3097145..3097600 | - | 456 | WP_000581502.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T270137 WP_000854690.1 NZ_CP117235:c3093231-3092854 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13745.37 Da Isoelectric Point: 4.6220
>AT270137 WP_001546171.1 NZ_CP117235:c3093688-3093320 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|