Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1835147..1835982 | Replicon | chromosome |
| Accession | NZ_CP117053 | ||
| Organism | Escherichia coli strain MLI106K4 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1X9TM58 |
| Locus tag | NL407_RS09960 | Protein ID | WP_000854761.1 |
| Coordinates | 1835147..1835524 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NL407_RS09965 | Protein ID | WP_222900822.1 |
| Coordinates | 1835614..1835982 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL407_RS09920 (1830536) | 1830536..1830901 | - | 366 | WP_001282181.1 | EutP/PduV family microcompartment system protein | - |
| NL407_RS09925 (1831172) | 1831172..1831543 | - | 372 | WP_272785021.1 | transposase | - |
| NL407_RS09930 (1831750) | 1831750..1831974 | - | 225 | Protein_1722 | transposase | - |
| NL407_RS09935 (1832055) | 1832055..1832459 | + | 405 | WP_000839179.1 | transposase | - |
| NL407_RS09940 (1832456) | 1832456..1832803 | + | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NL407_RS09945 (1832852) | 1832852..1834391 | + | 1540 | Protein_1725 | IS66-like element ISEc22 family transposase | - |
| NL407_RS09950 (1834822) | 1834822..1834902 | - | 81 | Protein_1726 | hypothetical protein | - |
| NL407_RS09955 (1835002) | 1835002..1835150 | - | 149 | Protein_1727 | DUF5983 family protein | - |
| NL407_RS09960 (1835147) | 1835147..1835524 | - | 378 | WP_000854761.1 | TA system toxin CbtA family protein | Toxin |
| NL407_RS09965 (1835614) | 1835614..1835982 | - | 369 | WP_222900822.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NL407_RS09970 (1836145) | 1836145..1836366 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NL407_RS09975 (1836429) | 1836429..1836905 | - | 477 | WP_001186711.1 | RadC family protein | - |
| NL407_RS09980 (1836920) | 1836920..1837393 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| NL407_RS09985 (1837735) | 1837735..1838553 | - | 819 | WP_001234729.1 | DUF932 domain-containing protein | - |
| NL407_RS09990 (1838671) | 1838671..1838866 | - | 196 | Protein_1734 | DUF905 family protein | - |
| NL407_RS09995 (1839012) | 1839012..1839758 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 1832055..1841314 | 9259 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14205.25 Da Isoelectric Point: 7.3249
>T269959 WP_000854761.1 NZ_CP117053:c1835524-1835147 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13606.42 Da Isoelectric Point: 6.6255
>AT269959 WP_222900822.1 NZ_CP117053:c1835982-1835614 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTLTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTLTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|