Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 5186018..5186239 Replicon chromosome
Accession NZ_CP117016
Organism Escherichia coli strain MLI121

Toxin (Protein)


Gene name ldrD Uniprot ID A0A7A6GBY2
Locus tag NL415_RS25785 Protein ID WP_000176714.1
Coordinates 5186018..5186125 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 5186173..5186239 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL415_RS25760 (5181863) 5181863..5182945 + 1083 WP_000804726.1 peptide chain release factor 1 -
NL415_RS25765 (5182945) 5182945..5183778 + 834 WP_000456477.1 peptide chain release factor N(5)-glutamine methyltransferase -
NL415_RS25770 (5183775) 5183775..5184167 + 393 WP_000200381.1 invasion regulator SirB2 -
NL415_RS25775 (5184171) 5184171..5184980 + 810 WP_001257044.1 invasion regulator SirB1 -
NL415_RS25780 (5185016) 5185016..5185870 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
NL415_RS25785 (5186018) 5186018..5186125 - 108 WP_000176714.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (5186175) 5186175..5186238 + 64 NuclAT_23 - -
- (5186175) 5186175..5186238 + 64 NuclAT_23 - -
- (5186175) 5186175..5186238 + 64 NuclAT_23 - -
- (5186175) 5186175..5186238 + 64 NuclAT_23 - -
- (5186175) 5186175..5186238 + 64 NuclAT_25 - -
- (5186175) 5186175..5186238 + 64 NuclAT_25 - -
- (5186175) 5186175..5186238 + 64 NuclAT_25 - -
- (5186175) 5186175..5186238 + 64 NuclAT_25 - -
- (5186175) 5186175..5186238 + 64 NuclAT_27 - -
- (5186175) 5186175..5186238 + 64 NuclAT_27 - -
- (5186175) 5186175..5186238 + 64 NuclAT_27 - -
- (5186175) 5186175..5186238 + 64 NuclAT_27 - -
- (5186175) 5186175..5186238 + 64 NuclAT_29 - -
- (5186175) 5186175..5186238 + 64 NuclAT_29 - -
- (5186175) 5186175..5186238 + 64 NuclAT_29 - -
- (5186175) 5186175..5186238 + 64 NuclAT_29 - -
- (5186175) 5186175..5186238 + 64 NuclAT_31 - -
- (5186175) 5186175..5186238 + 64 NuclAT_31 - -
- (5186175) 5186175..5186238 + 64 NuclAT_31 - -
- (5186175) 5186175..5186238 + 64 NuclAT_31 - -
- (5186175) 5186175..5186238 + 64 NuclAT_33 - -
- (5186175) 5186175..5186238 + 64 NuclAT_33 - -
- (5186175) 5186175..5186238 + 64 NuclAT_33 - -
- (5186175) 5186175..5186238 + 64 NuclAT_33 - -
- (5186173) 5186173..5186239 + 67 NuclAT_10 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_10 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_10 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_10 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_12 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_12 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_12 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_12 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_14 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_14 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_14 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_14 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_16 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_16 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_16 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_16 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_18 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_18 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_18 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_18 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_20 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_20 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_20 - Antitoxin
- (5186173) 5186173..5186239 + 67 NuclAT_20 - Antitoxin
- (5186175) 5186175..5186240 + 66 NuclAT_35 - -
- (5186175) 5186175..5186240 + 66 NuclAT_35 - -
- (5186175) 5186175..5186240 + 66 NuclAT_35 - -
- (5186175) 5186175..5186240 + 66 NuclAT_35 - -
- (5186175) 5186175..5186240 + 66 NuclAT_37 - -
- (5186175) 5186175..5186240 + 66 NuclAT_37 - -
- (5186175) 5186175..5186240 + 66 NuclAT_37 - -
- (5186175) 5186175..5186240 + 66 NuclAT_37 - -
- (5186175) 5186175..5186240 + 66 NuclAT_39 - -
- (5186175) 5186175..5186240 + 66 NuclAT_39 - -
- (5186175) 5186175..5186240 + 66 NuclAT_39 - -
- (5186175) 5186175..5186240 + 66 NuclAT_39 - -
- (5186175) 5186175..5186240 + 66 NuclAT_41 - -
- (5186175) 5186175..5186240 + 66 NuclAT_41 - -
- (5186175) 5186175..5186240 + 66 NuclAT_41 - -
- (5186175) 5186175..5186240 + 66 NuclAT_41 - -
NL415_RS25790 (5186553) 5186553..5186660 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (5186713) 5186713..5186774 + 62 NuclAT_22 - -
- (5186713) 5186713..5186774 + 62 NuclAT_22 - -
- (5186713) 5186713..5186774 + 62 NuclAT_22 - -
- (5186713) 5186713..5186774 + 62 NuclAT_22 - -
- (5186713) 5186713..5186774 + 62 NuclAT_24 - -
- (5186713) 5186713..5186774 + 62 NuclAT_24 - -
- (5186713) 5186713..5186774 + 62 NuclAT_24 - -
- (5186713) 5186713..5186774 + 62 NuclAT_24 - -
- (5186713) 5186713..5186774 + 62 NuclAT_26 - -
- (5186713) 5186713..5186774 + 62 NuclAT_26 - -
- (5186713) 5186713..5186774 + 62 NuclAT_26 - -
- (5186713) 5186713..5186774 + 62 NuclAT_26 - -
- (5186713) 5186713..5186774 + 62 NuclAT_28 - -
- (5186713) 5186713..5186774 + 62 NuclAT_28 - -
- (5186713) 5186713..5186774 + 62 NuclAT_28 - -
- (5186713) 5186713..5186774 + 62 NuclAT_28 - -
- (5186713) 5186713..5186774 + 62 NuclAT_30 - -
- (5186713) 5186713..5186774 + 62 NuclAT_30 - -
- (5186713) 5186713..5186774 + 62 NuclAT_30 - -
- (5186713) 5186713..5186774 + 62 NuclAT_30 - -
- (5186713) 5186713..5186774 + 62 NuclAT_32 - -
- (5186713) 5186713..5186774 + 62 NuclAT_32 - -
- (5186713) 5186713..5186774 + 62 NuclAT_32 - -
- (5186713) 5186713..5186774 + 62 NuclAT_32 - -
- (5186713) 5186713..5186775 + 63 NuclAT_11 - -
- (5186713) 5186713..5186775 + 63 NuclAT_11 - -
- (5186713) 5186713..5186775 + 63 NuclAT_11 - -
- (5186713) 5186713..5186775 + 63 NuclAT_11 - -
- (5186713) 5186713..5186775 + 63 NuclAT_13 - -
- (5186713) 5186713..5186775 + 63 NuclAT_13 - -
- (5186713) 5186713..5186775 + 63 NuclAT_13 - -
- (5186713) 5186713..5186775 + 63 NuclAT_13 - -
- (5186713) 5186713..5186775 + 63 NuclAT_15 - -
- (5186713) 5186713..5186775 + 63 NuclAT_15 - -
- (5186713) 5186713..5186775 + 63 NuclAT_15 - -
- (5186713) 5186713..5186775 + 63 NuclAT_15 - -
- (5186713) 5186713..5186775 + 63 NuclAT_17 - -
- (5186713) 5186713..5186775 + 63 NuclAT_17 - -
- (5186713) 5186713..5186775 + 63 NuclAT_17 - -
- (5186713) 5186713..5186775 + 63 NuclAT_17 - -
- (5186713) 5186713..5186775 + 63 NuclAT_19 - -
- (5186713) 5186713..5186775 + 63 NuclAT_19 - -
- (5186713) 5186713..5186775 + 63 NuclAT_19 - -
- (5186713) 5186713..5186775 + 63 NuclAT_19 - -
- (5186713) 5186713..5186775 + 63 NuclAT_21 - -
- (5186713) 5186713..5186775 + 63 NuclAT_21 - -
- (5186713) 5186713..5186775 + 63 NuclAT_21 - -
- (5186713) 5186713..5186775 + 63 NuclAT_21 - -
- (5186713) 5186713..5186776 + 64 NuclAT_34 - -
- (5186713) 5186713..5186776 + 64 NuclAT_34 - -
- (5186713) 5186713..5186776 + 64 NuclAT_34 - -
- (5186713) 5186713..5186776 + 64 NuclAT_34 - -
- (5186713) 5186713..5186776 + 64 NuclAT_36 - -
- (5186713) 5186713..5186776 + 64 NuclAT_36 - -
- (5186713) 5186713..5186776 + 64 NuclAT_36 - -
- (5186713) 5186713..5186776 + 64 NuclAT_36 - -
- (5186713) 5186713..5186776 + 64 NuclAT_38 - -
- (5186713) 5186713..5186776 + 64 NuclAT_38 - -
- (5186713) 5186713..5186776 + 64 NuclAT_38 - -
- (5186713) 5186713..5186776 + 64 NuclAT_38 - -
- (5186713) 5186713..5186776 + 64 NuclAT_40 - -
- (5186713) 5186713..5186776 + 64 NuclAT_40 - -
- (5186713) 5186713..5186776 + 64 NuclAT_40 - -
- (5186713) 5186713..5186776 + 64 NuclAT_40 - -
NL415_RS25795 (5187066) 5187066..5188166 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
NL415_RS25800 (5188436) 5188436..5188666 + 231 WP_001146444.1 putative cation transport regulator ChaB -
NL415_RS25805 (5188824) 5188824..5189519 + 696 WP_001469092.1 glutathione-specific gamma-glutamylcyclotransferase -
NL415_RS25810 (5189563) 5189563..5189916 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4061.82 Da        Isoelectric Point: 11.4779

>T269847 WP_000176714.1 NZ_CP117016:c5186125-5186018 [Escherichia coli]
MTLTQFAMTFWHDLATPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT269847 NZ_CP117016:5186173-5186239 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7A6GBY2

Antitoxin

Download structure file

References