Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3457861..3458566 | Replicon | chromosome |
| Accession | NZ_CP117008 | ||
| Organism | Escherichia coli strain MLI109 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | NL412_RS17985 | Protein ID | WP_000539521.1 |
| Coordinates | 3457861..3458247 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NL412_RS17990 | Protein ID | WP_001280945.1 |
| Coordinates | 3458237..3458566 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL412_RS17965 (3453865) | 3453865..3454491 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
| NL412_RS17970 (3454488) | 3454488..3455603 | - | 1116 | WP_000555051.1 | aldose sugar dehydrogenase YliI | - |
| NL412_RS17975 (3455714) | 3455714..3456097 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| NL412_RS17980 (3456310) | 3456310..3457635 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| NL412_RS17985 (3457861) | 3457861..3458247 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL412_RS17990 (3458237) | 3458237..3458566 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| NL412_RS17995 (3458636) | 3458636..3459964 | - | 1329 | WP_001550887.1 | GGDEF domain-containing protein | - |
| NL412_RS18000 (3459972) | 3459972..3462320 | - | 2349 | WP_001550886.1 | EAL domain-containing protein | - |
| NL412_RS18005 (3462498) | 3462498..3463409 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T269779 WP_000539521.1 NZ_CP117008:3457861-3458247 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|