Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1993816..1994647 Replicon chromosome
Accession NZ_CP117008
Organism Escherichia coli strain MLI109

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag NL412_RS10370 Protein ID WP_000854814.1
Coordinates 1993816..1994190 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag NL412_RS10375 Protein ID WP_001285585.1
Coordinates 1994279..1994647 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL412_RS10330 (1989212) 1989212..1990378 + 1167 WP_042105928.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
NL412_RS10335 (1990497) 1990497..1990970 + 474 WP_001105415.1 DNA gyrase inhibitor SbmC -
NL412_RS10340 (1991168) 1991168..1992226 + 1059 WP_001200891.1 FUSC family protein -
NL412_RS10345 (1992398) 1992398..1992727 + 330 WP_000450409.1 DUF496 family protein -
NL412_RS10350 (1992828) 1992828..1992962 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
NL412_RS10355 (1993082) 1993082..1993210 + 129 Protein_1866 transposase domain-containing protein -
NL412_RS10360 (1993499) 1993499..1993579 - 81 Protein_1867 hypothetical protein -
NL412_RS10365 (1993625) 1993625..1993819 - 195 WP_000988600.1 DUF5983 family protein -
NL412_RS10370 (1993816) 1993816..1994190 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
NL412_RS10375 (1994279) 1994279..1994647 - 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
NL412_RS10380 (1994721) 1994721..1994942 - 222 WP_000692323.1 DUF987 domain-containing protein -
NL412_RS10385 (1995005) 1995005..1995481 - 477 WP_001186773.1 RadC family protein -
NL412_RS10390 (1995497) 1995497..1995976 - 480 WP_000860076.1 antirestriction protein -
NL412_RS10395 (1996058) 1996058..1996876 - 819 WP_001234629.1 DUF932 domain-containing protein -
NL412_RS10400 (1996976) 1996976..1997209 - 234 WP_001119729.1 DUF905 family protein -
NL412_RS10405 (1997288) 1997288..1997743 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T269771 WP_000854814.1 NZ_CP117008:c1994190-1993816 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT269771 WP_001285585.1 NZ_CP117008:c1994647-1994279 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References