Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 835893..836725 Replicon chromosome
Accession NZ_CP117008
Organism Escherichia coli strain MLI109

Toxin (Protein)


Gene name yeeV Uniprot ID A7ZVJ9
Locus tag NL412_RS04790 Protein ID WP_000854765.1
Coordinates 835893..836267 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag NL412_RS04795 Protein ID WP_001295723.1
Coordinates 836357..836725 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL412_RS04760 (831018) 831018..832166 - 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -
NL412_RS04765 (832238) 832238..833221 - 984 WP_001296394.1 KpsF/GutQ family sugar-phosphate isomerase -
NL412_RS04770 (834031) 834031..834201 - 171 Protein_775 IS110 family transposase -
NL412_RS04775 (834544) 834544..835386 - 843 WP_022645115.1 DUF4942 domain-containing protein -
NL412_RS04780 (835471) 835471..835665 - 195 WP_024181941.1 DUF957 domain-containing protein -
NL412_RS04785 (835690) 835690..835893 - 204 WP_001398797.1 DUF5983 family protein -
NL412_RS04790 (835893) 835893..836267 - 375 WP_000854765.1 TA system toxin CbtA family protein Toxin
NL412_RS04795 (836357) 836357..836725 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NL412_RS04800 (836888) 836888..837109 - 222 WP_000692341.1 DUF987 domain-containing protein -
NL412_RS04805 (837172) 837172..837648 - 477 WP_001186774.1 RadC family protein -
NL412_RS04810 (837664) 837664..838143 - 480 WP_057109541.1 antirestriction protein -
NL412_RS04815 (838409) 838409..839227 - 819 WP_001175165.1 DUF932 domain-containing protein -
NL412_RS04820 (839317) 839317..839550 - 234 WP_001278293.1 DUF905 family protein -
NL412_RS04825 (839556) 839556..840233 - 678 WP_001097302.1 hypothetical protein -
NL412_RS04830 (840381) 840381..841061 - 681 WP_001282921.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / kpsM / kpsT / ugd / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF 712638..893898 181260


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13970.98 Da        Isoelectric Point: 7.2909

>T269766 WP_000854765.1 NZ_CP117008:c836267-835893 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT269766 WP_001295723.1 NZ_CP117008:c836725-836357 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZVJ9

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References