Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 139192..139423 | Replicon | plasmid p140_MLI109 |
| Accession | NZ_CP117007 | ||
| Organism | Escherichia coli strain MLI109 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | NL412_RS00810 | Protein ID | WP_023144756.1 |
| Coordinates | 139289..139423 (+) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 139192..139243 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL412_RS00790 (136722) | 136722..137468 | + | 747 | WP_000205736.1 | conjugal transfer pilus acetylase TraX | - |
| NL412_RS00795 (137523) | 137523..138083 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| NL412_RS00800 (138215) | 138215..138427 | + | 213 | WP_072042863.1 | ANR family transcriptional regulator | - |
| NL412_RS00805 (138939) | 138939..139225 | + | 287 | Protein_160 | DUF2726 domain-containing protein | - |
| - (139192) | 139192..139243 | - | 52 | NuclAT_1 | - | Antitoxin |
| - (139192) | 139192..139243 | - | 52 | NuclAT_1 | - | Antitoxin |
| - (139192) | 139192..139243 | - | 52 | NuclAT_1 | - | Antitoxin |
| - (139192) | 139192..139243 | - | 52 | NuclAT_1 | - | Antitoxin |
| NL412_RS00810 (139289) | 139289..139423 | + | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| NL412_RS00815 (139720) | 139720..139974 | + | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | agg3D / agg3C / agg3B / aap/aspU / pic | 1..140278 | 140278 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T269763 WP_023144756.1 NZ_CP117007:139289-139423 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 52 bp
>AT269763 NZ_CP117007:c139243-139192 [Escherichia coli]
TCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|