Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4690793..4691395 | Replicon | chromosome |
Accession | NZ_CP117006 | ||
Organism | Escherichia coli strain MLI108K3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NL411_RS24280 | Protein ID | WP_000897305.1 |
Coordinates | 4691084..4691395 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NL411_RS24275 | Protein ID | WP_000356395.1 |
Coordinates | 4690793..4691083 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL411_RS24240 (4686417) | 4686417..4687319 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
NL411_RS24245 (4687316) | 4687316..4687951 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NL411_RS24250 (4687948) | 4687948..4688877 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
NL411_RS24255 (4689059) | 4689059..4689301 | - | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
NL411_RS24260 (4689520) | 4689520..4689738 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
NL411_RS24265 (4690157) | 4690157..4690435 | - | 279 | WP_001315112.1 | hypothetical protein | - |
NL411_RS24270 (4690487) | 4690487..4690708 | - | 222 | WP_001550354.1 | hypothetical protein | - |
NL411_RS24275 (4690793) | 4690793..4691083 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
NL411_RS24280 (4691084) | 4691084..4691395 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NL411_RS24285 (4691624) | 4691624..4692532 | + | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
NL411_RS24290 (4692700) | 4692700..4693614 | - | 915 | WP_109553727.1 | transposase | - |
NL411_RS24295 (4693627) | 4693627..4694514 | - | 888 | Protein_4426 | hypothetical protein | - |
NL411_RS24300 (4694930) | 4694930..4695871 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NL411_RS24305 (4695916) | 4695916..4696353 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T269756 WP_000897305.1 NZ_CP117006:c4691395-4691084 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|