Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2897412..2898196 | Replicon | chromosome |
Accession | NZ_CP117006 | ||
Organism | Escherichia coli strain MLI108K3 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | NL411_RS15765 | Protein ID | WP_000613626.1 |
Coordinates | 2897702..2898196 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | NL411_RS15760 | Protein ID | WP_001110447.1 |
Coordinates | 2897412..2897705 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL411_RS15750 (2892562) | 2892562..2893521 | - | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
NL411_RS15755 (2894094) | 2894094..2897279 | + | 3186 | WP_001550951.1 | ribonuclease E | - |
NL411_RS15760 (2897412) | 2897412..2897705 | + | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
NL411_RS15765 (2897702) | 2897702..2898196 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
NL411_RS15770 (2898291) | 2898291..2899244 | - | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
NL411_RS15775 (2899256) | 2899256..2900899 | - | 1644 | WP_000096478.1 | flagellar hook-associated protein FlgK | - |
NL411_RS15780 (2900965) | 2900965..2901906 | - | 942 | WP_001366226.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
NL411_RS15785 (2901906) | 2901906..2903003 | - | 1098 | WP_001441925.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T269749 WP_000613626.1 NZ_CP117006:2897702-2898196 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|