Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 79760..80285 Replicon plasmid p89_MLI108-3
Accession NZ_CP117004
Organism Escherichia coli strain MLI108K3

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NL411_RS01570 Protein ID WP_001159871.1
Coordinates 79760..80065 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q0H051
Locus tag NL411_RS01575 Protein ID WP_000813637.1
Coordinates 80067..80285 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL411_RS01540 (75309) 75309..76297 + 989 Protein_87 translesion error-prone DNA polymerase V subunit UmuC -
NL411_RS01545 (76302) 76302..76694 - 393 WP_000340833.1 plasmid partitioning/stability family protein -
NL411_RS01550 (76699) 76699..77670 - 972 WP_001103694.1 plasmid segregation protein ParM -
NL411_RS01555 (77899) 77899..78543 + 645 WP_000633911.1 AAA family ATPase -
NL411_RS01560 (78537) 78537..78812 + 276 WP_000239529.1 hypothetical protein -
NL411_RS01565 (78950) 78950..79759 - 810 WP_255091787.1 site-specific integrase -
NL411_RS01570 (79760) 79760..80065 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NL411_RS01575 (80067) 80067..80285 - 219 WP_000813637.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NL411_RS01580 (80865) 80865..81953 + 1089 WP_000952217.1 transcriptional repressor PifC -
NL411_RS01585 (81955) 81955..84180 + 2226 WP_128550551.1 P-loop NTPase fold protein -
NL411_RS01590 (84230) 84230..85129 - 900 WP_000963206.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..89004 89004


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T269735 WP_001159871.1 NZ_CP117004:c80065-79760 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8428.45 Da        Isoelectric Point: 4.7405

>AT269735 WP_000813637.1 NZ_CP117004:c80285-80067 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWKVENQEGMVEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB Q0H051

References