Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3304969..3305587 | Replicon | chromosome |
Accession | NZ_CP116929 | ||
Organism | Escherichia coli strain MLI105 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NL421_RS16385 | Protein ID | WP_001291435.1 |
Coordinates | 3305369..3305587 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NL421_RS16380 | Protein ID | WP_000344800.1 |
Coordinates | 3304969..3305343 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL421_RS16370 (3300058) | 3300058..3301251 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NL421_RS16375 (3301274) | 3301274..3304423 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NL421_RS16380 (3304969) | 3304969..3305343 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NL421_RS16385 (3305369) | 3305369..3305587 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NL421_RS16390 (3305759) | 3305759..3306310 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NL421_RS16395 (3306426) | 3306426..3306896 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NL421_RS16400 (3307060) | 3307060..3308610 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NL421_RS16405 (3308652) | 3308652..3309005 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NL421_RS16415 (3309384) | 3309384..3309695 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NL421_RS16420 (3309726) | 3309726..3310298 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T269486 WP_001291435.1 NZ_CP116929:3305369-3305587 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT269486 WP_000344800.1 NZ_CP116929:3304969-3305343 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |