Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3306854..3307649 Replicon chromosome
Accession NZ_CP116919
Organism Escherichia coli strain MLI102

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag NL418_RS16955 Protein ID WP_272773424.1
Coordinates 3306854..3307228 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID D2ACA1
Locus tag NL418_RS16960 Protein ID WP_001280958.1
Coordinates 3307275..3307649 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL418_RS16915 (3302175) 3302175..3302879 + 705 WP_001241678.1 leucyl/phenylalanyl-tRNA--protein transferase -
NL418_RS16920 (3303164) 3303164..3303382 + 219 WP_001040187.1 translation initiation factor IF-1 -
NL418_RS16930 (3303873) 3303873..3304154 - 282 Protein_3183 DUF4942 domain-containing protein -
NL418_RS16935 (3304436) 3304436..3305440 - 1005 WP_001179707.1 IS110-like element ISSfl8 family transposase -
NL418_RS16940 (3305512) 3305512..3306072 - 561 Protein_3185 DUF4942 domain-containing protein -
NL418_RS16945 (3306157) 3306157..3306354 - 198 WP_000839282.1 DUF957 domain-containing protein -
NL418_RS16950 (3306366) 3306366..3306857 - 492 WP_000976828.1 DUF5983 family protein -
NL418_RS16955 (3306854) 3306854..3307228 - 375 WP_272773424.1 TA system toxin CbtA family protein Toxin
NL418_RS16960 (3307275) 3307275..3307649 - 375 WP_001280958.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NL418_RS16965 (3307812) 3307812..3308034 - 223 Protein_3190 DUF987 domain-containing protein -
NL418_RS16970 (3308097) 3308097..3308573 - 477 WP_272773425.1 RadC family protein -
NL418_RS16975 (3308588) 3308588..3309068 - 481 Protein_3192 antirestriction protein -
NL418_RS16980 (3309218) 3309218..3309370 - 153 WP_272773426.1 hypothetical protein -
NL418_RS16985 (3309384) 3309384..3310203 - 820 Protein_3194 DUF932 domain-containing protein -
NL418_RS16990 (3310294) 3310294..3310467 - 174 WP_272773427.1 DUF905 family protein -
NL418_RS16995 (3310587) 3310587..3310829 - 243 WP_000348966.1 DNA polymerase III subunit gamma/tau -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3252470..3325570 73100
- flank IS/Tn - - 3304436..3305440 1004
- flank IS/Tn - - 3311033..3311536 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14119.19 Da        Isoelectric Point: 7.7761

>T269422 WP_272773424.1 NZ_CP116919:c3307228-3306854 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13793.62 Da        Isoelectric Point: 6.4651

>AT269422 WP_001280958.1 NZ_CP116919:c3307649-3307275 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLYYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0K4PAV2

References