Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 858910..859742 Replicon chromosome
Accession NZ_CP116919
Organism Escherichia coli strain MLI102

Toxin (Protein)


Gene name yeeV Uniprot ID A7ZVJ9
Locus tag NL418_RS04855 Protein ID WP_000854765.1
Coordinates 858910..859284 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag NL418_RS04860 Protein ID WP_001295723.1
Coordinates 859374..859742 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL418_RS04825 (854035) 854035..855183 - 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -
NL418_RS04830 (855255) 855255..856238 - 984 WP_001296394.1 KpsF/GutQ family sugar-phosphate isomerase -
NL418_RS04835 (857048) 857048..857218 - 171 Protein_815 IS110 family transposase -
NL418_RS04840 (857561) 857561..858403 - 843 WP_022645115.1 DUF4942 domain-containing protein -
NL418_RS04845 (858488) 858488..858682 - 195 WP_024181941.1 DUF957 domain-containing protein -
NL418_RS04850 (858707) 858707..858910 - 204 WP_001398797.1 DUF5983 family protein -
NL418_RS04855 (858910) 858910..859284 - 375 WP_000854765.1 TA system toxin CbtA family protein Toxin
NL418_RS04860 (859374) 859374..859742 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NL418_RS04865 (859943) 859943..860164 - 222 WP_000692341.1 DUF987 domain-containing protein -
NL418_RS04870 (860227) 860227..860703 - 477 WP_001186774.1 RadC family protein -
NL418_RS04875 (860719) 860719..861198 - 480 WP_057109541.1 antirestriction protein -
NL418_RS04880 (861465) 861465..862283 - 819 WP_001175165.1 DUF932 domain-containing protein -
NL418_RS04885 (862373) 862373..862606 - 234 WP_001278293.1 DUF905 family protein -
NL418_RS04890 (862612) 862612..863289 - 678 WP_001097302.1 hypothetical protein -
NL418_RS04895 (863437) 863437..864117 - 681 WP_001282921.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13970.98 Da        Isoelectric Point: 7.2909

>T269413 WP_000854765.1 NZ_CP116919:c859284-858910 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT269413 WP_001295723.1 NZ_CP116919:c859742-859374 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZVJ9

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References