Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 27860..28461 Replicon plasmid p89_MLI23-2
Accession NZ_CP116914
Organism Escherichia coli strain MLI023K2

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag NL417_RS00150 Protein ID WP_001216034.1
Coordinates 27860..28240 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NL417_RS00155 Protein ID WP_001190712.1
Coordinates 28240..28461 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL417_RS00115 (NL417_000115) 22911..23843 - 933 WP_000081352.1 homocysteine S-methyltransferase -
NL417_RS00120 (NL417_000120) 23830..25233 - 1404 WP_001373486.1 S-methylmethionine permease -
NL417_RS00125 (NL417_000125) 25477..26457 + 981 Protein_24 IS5-like element IS5 family transposase -
NL417_RS00130 (NL417_000130) 26667..27002 + 336 WP_169329198.1 type I deoxyribonuclease HsdR -
NL417_RS00135 (NL417_000135) 26952..27365 - 414 Protein_26 integrase core domain-containing protein -
NL417_RS00140 (NL417_000140) 27370..27648 - 279 Protein_27 pdcB -
NL417_RS00145 (NL417_000145) 27676..27855 - 180 WP_001513661.1 hypothetical protein -
NL417_RS00150 (NL417_000150) 27860..28240 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NL417_RS00155 (NL417_000155) 28240..28461 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NL417_RS00160 (NL417_000160) 28724..29421 + 698 WP_103215986.1 IS1-like element IS1A family transposase -
NL417_RS00165 (NL417_000165) 29608..29901 - 294 WP_226438991.1 biofilm development regulator YmgB/AriR family protein -
NL417_RS00170 (NL417_000170) 30205..30309 - 105 Protein_33 IS3 family transposase -
NL417_RS00175 (NL417_000175) 30336..30485 - 150 Protein_34 IS3 family transposase -
NL417_RS00185 (NL417_000185) 31699..32313 + 615 WP_032214276.1 acid-sensing system DNA-binding response regulator EvgA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA14 / qnrS1 / blaCTX-M-15 / blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 - 1..89725 89725
- inside IScluster/Tn - - 20683..30921 10238


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T269395 WP_001216034.1 NZ_CP116914:c28240-27860 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT269395 WP_001190712.1 NZ_CP116914:c28461-28240 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References