Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 27860..28461 | Replicon | plasmid p89_MLI23-2 |
Accession | NZ_CP116914 | ||
Organism | Escherichia coli strain MLI023K2 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V0AJ64 |
Locus tag | NL417_RS00150 | Protein ID | WP_001216034.1 |
Coordinates | 27860..28240 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | NL417_RS00155 | Protein ID | WP_001190712.1 |
Coordinates | 28240..28461 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL417_RS00115 (NL417_000115) | 22911..23843 | - | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
NL417_RS00120 (NL417_000120) | 23830..25233 | - | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
NL417_RS00125 (NL417_000125) | 25477..26457 | + | 981 | Protein_24 | IS5-like element IS5 family transposase | - |
NL417_RS00130 (NL417_000130) | 26667..27002 | + | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
NL417_RS00135 (NL417_000135) | 26952..27365 | - | 414 | Protein_26 | integrase core domain-containing protein | - |
NL417_RS00140 (NL417_000140) | 27370..27648 | - | 279 | Protein_27 | pdcB | - |
NL417_RS00145 (NL417_000145) | 27676..27855 | - | 180 | WP_001513661.1 | hypothetical protein | - |
NL417_RS00150 (NL417_000150) | 27860..28240 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NL417_RS00155 (NL417_000155) | 28240..28461 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NL417_RS00160 (NL417_000160) | 28724..29421 | + | 698 | WP_103215986.1 | IS1-like element IS1A family transposase | - |
NL417_RS00165 (NL417_000165) | 29608..29901 | - | 294 | WP_226438991.1 | biofilm development regulator YmgB/AriR family protein | - |
NL417_RS00170 (NL417_000170) | 30205..30309 | - | 105 | Protein_33 | IS3 family transposase | - |
NL417_RS00175 (NL417_000175) | 30336..30485 | - | 150 | Protein_34 | IS3 family transposase | - |
NL417_RS00185 (NL417_000185) | 31699..32313 | + | 615 | WP_032214276.1 | acid-sensing system DNA-binding response regulator EvgA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | dfrA14 / qnrS1 / blaCTX-M-15 / blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..89725 | 89725 | |
- | inside | IScluster/Tn | - | - | 20683..30921 | 10238 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T269395 WP_001216034.1 NZ_CP116914:c28240-27860 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AJ64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |