Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4229699..4230543 Replicon chromosome
Accession NZ_CP116900
Organism Escherichia coli strain XH2172

Toxin (Protein)


Gene name yeeV Uniprot ID B1LJY4
Locus tag PH219_RS20470 Protein ID WP_000854686.1
Coordinates 4229699..4230082 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A8E0J1S3
Locus tag PH219_RS20475 Protein ID WP_001285602.1
Coordinates 4230163..4230543 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PH219_RS20430 (4224702) 4224702..4225193 - 492 WP_001297187.1 DUF1097 domain-containing protein -
PH219_RS20435 (4225295) 4225295..4225849 - 555 WP_001001902.1 molecular chaperone YcdY -
PH219_RS20440 (4225873) 4225873..4226610 - 738 WP_000283664.1 zinc-binding phosphatase -
PH219_RS20445 (4226665) 4226665..4227603 - 939 WP_000351311.1 glyoxylate/hydroxypyruvate reductase GhrA -
PH219_RS20455 (4228074) 4228074..4228915 - 842 Protein_3990 DUF4942 domain-containing protein -
PH219_RS20460 (4229000) 4229000..4229197 - 198 WP_000839253.1 DUF957 domain-containing protein -
PH219_RS20465 (4229214) 4229214..4229702 - 489 WP_032180032.1 DUF5983 family protein -
PH219_RS20470 (4229699) 4229699..4230082 - 384 WP_000854686.1 TA system toxin CbtA family protein Toxin
PH219_RS20475 (4230163) 4230163..4230543 - 381 WP_001285602.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PH219_RS20480 (4230554) 4230554..4231237 - 684 WP_000086768.1 hypothetical protein -
PH219_RS20485 (4231256) 4231256..4231477 - 222 WP_000692298.1 DUF987 domain-containing protein -
PH219_RS20490 (4231540) 4231540..4232016 - 477 WP_001186726.1 RadC family protein -
PH219_RS20495 (4232032) 4232032..4232517 - 486 WP_000214307.1 antirestriction protein -
PH219_RS20500 (4232609) 4232609..4233430 - 822 WP_001761104.1 DUF932 domain-containing protein -
PH219_RS20505 (4233531) 4233531..4233739 - 209 Protein_4000 DUF905 family protein -
PH219_RS20510 (4233840) 4233840..4234295 - 456 WP_000581506.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island blaCMY-2 csgB / csgD / csgE / csgF / csgG 4221096..4277050 55954


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-113)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14272.28 Da        Isoelectric Point: 6.8614

>T269327 WP_000854686.1 NZ_CP116900:c4230082-4229699 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ

Download         Length: 384 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13938.69 Da        Isoelectric Point: 5.0823

>AT269327 WP_001285602.1 NZ_CP116900:c4230543-4230163 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References