Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 240190..240832 | Replicon | chromosome |
Accession | NZ_CP116889 | ||
Organism | Bacillus anthracis strain AN17-384_2 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | J8CWW5 |
Locus tag | PP184_RS01340 | Protein ID | WP_000635963.1 |
Coordinates | 240482..240832 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | PP184_RS01335 | Protein ID | WP_000004570.1 |
Coordinates | 240190..240477 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PP184_RS01310 (PP184_01310) | 235506..236468 | + | 963 | WP_000961037.1 | UV DNA damage repair endonuclease UvsE | - |
PP184_RS01315 (PP184_01315) | 236461..237033 | - | 573 | WP_000906916.1 | rhomboid family intramembrane serine protease | - |
PP184_RS01320 (PP184_01320) | 237126..237485 | + | 360 | WP_000635040.1 | holo-ACP synthase | - |
PP184_RS01325 (PP184_01325) | 237642..238592 | + | 951 | WP_025388382.1 | outer membrane lipoprotein carrier protein LolA | - |
PP184_RS01330 (PP184_01330) | 238711..239880 | + | 1170 | WP_000390596.1 | alanine racemase | - |
PP184_RS01335 (PP184_01335) | 240190..240477 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
PP184_RS01340 (PP184_01340) | 240482..240832 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PP184_RS01345 (PP184_01345) | 240900..243068 | + | 2169 | WP_000426225.1 | Tex family protein | - |
PP184_RS01350 (PP184_01350) | 243126..243242 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
PP184_RS01355 (PP184_01355) | 243438..243896 | + | 459 | WP_000344248.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T269304 WP_000635963.1 NZ_CP116889:240482-240832 [Bacillus anthracis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4HKE | |
PDB | 7BXY |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |