Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 5608546..5609160 | Replicon | chromosome |
| Accession | NZ_CP116715 | ||
| Organism | Pseudomonas aeruginosa strain 2856 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A6VBH9 |
| Locus tag | PMJ91_RS26745 | Protein ID | WP_071534354.1 |
| Coordinates | 5608978..5609160 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A140SDX7 |
| Locus tag | PMJ91_RS26740 | Protein ID | WP_012077229.1 |
| Coordinates | 5608546..5608950 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PMJ91_RS26715 (PMJ91_26715) | 5604686..5605396 | + | 711 | WP_012074129.1 | hypothetical protein | - |
| PMJ91_RS26720 (PMJ91_26720) | 5605393..5606313 | + | 921 | WP_012074128.1 | hypothetical protein | - |
| PMJ91_RS26725 (PMJ91_26725) | 5606310..5606849 | + | 540 | WP_012074127.1 | hypothetical protein | - |
| PMJ91_RS26730 (PMJ91_26730) | 5606849..5607547 | + | 699 | WP_033896049.1 | hypothetical protein | - |
| PMJ91_RS26735 (PMJ91_26735) | 5607532..5608503 | + | 972 | WP_012077228.1 | hypothetical protein | - |
| PMJ91_RS26740 (PMJ91_26740) | 5608546..5608950 | - | 405 | WP_012077229.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PMJ91_RS26745 (PMJ91_26745) | 5608978..5609160 | - | 183 | WP_071534354.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PMJ91_RS26750 (PMJ91_26750) | 5609703..5610635 | - | 933 | WP_003120918.1 | ZIP family metal transporter | - |
| PMJ91_RS26755 (PMJ91_26755) | 5610654..5611265 | - | 612 | WP_003098862.1 | superoxide dismutase | - |
| PMJ91_RS26760 (PMJ91_26760) | 5611278..5611727 | - | 450 | WP_003094369.1 | hypothetical protein | - |
| PMJ91_RS26765 (PMJ91_26765) | 5611755..5613131 | - | 1377 | WP_003098863.1 | class II fumarate hydratase FumC | - |
| PMJ91_RS26770 (PMJ91_26770) | 5613124..5613519 | - | 396 | WP_003162782.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 5571667..5609160 | 37493 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6702.74 Da Isoelectric Point: 10.4826
>T269154 WP_071534354.1 NZ_CP116715:c5609160-5608978 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14670.54 Da Isoelectric Point: 4.4315
>AT269154 WP_012077229.1 NZ_CP116715:c5608950-5608546 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6VBH9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A140SDX7 |