Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 5608546..5609160 Replicon chromosome
Accession NZ_CP116715
Organism Pseudomonas aeruginosa strain 2856

Toxin (Protein)


Gene name hicA Uniprot ID A6VBH9
Locus tag PMJ91_RS26745 Protein ID WP_071534354.1
Coordinates 5608978..5609160 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A140SDX7
Locus tag PMJ91_RS26740 Protein ID WP_012077229.1
Coordinates 5608546..5608950 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PMJ91_RS26715 (PMJ91_26715) 5604686..5605396 + 711 WP_012074129.1 hypothetical protein -
PMJ91_RS26720 (PMJ91_26720) 5605393..5606313 + 921 WP_012074128.1 hypothetical protein -
PMJ91_RS26725 (PMJ91_26725) 5606310..5606849 + 540 WP_012074127.1 hypothetical protein -
PMJ91_RS26730 (PMJ91_26730) 5606849..5607547 + 699 WP_033896049.1 hypothetical protein -
PMJ91_RS26735 (PMJ91_26735) 5607532..5608503 + 972 WP_012077228.1 hypothetical protein -
PMJ91_RS26740 (PMJ91_26740) 5608546..5608950 - 405 WP_012077229.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PMJ91_RS26745 (PMJ91_26745) 5608978..5609160 - 183 WP_071534354.1 type II toxin-antitoxin system HicA family toxin Toxin
PMJ91_RS26750 (PMJ91_26750) 5609703..5610635 - 933 WP_003120918.1 ZIP family metal transporter -
PMJ91_RS26755 (PMJ91_26755) 5610654..5611265 - 612 WP_003098862.1 superoxide dismutase -
PMJ91_RS26760 (PMJ91_26760) 5611278..5611727 - 450 WP_003094369.1 hypothetical protein -
PMJ91_RS26765 (PMJ91_26765) 5611755..5613131 - 1377 WP_003098863.1 class II fumarate hydratase FumC -
PMJ91_RS26770 (PMJ91_26770) 5613124..5613519 - 396 WP_003162782.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 5571667..5609160 37493


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6702.74 Da        Isoelectric Point: 10.4826

>T269154 WP_071534354.1 NZ_CP116715:c5609160-5608978 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14670.54 Da        Isoelectric Point: 4.4315

>AT269154 WP_012077229.1 NZ_CP116715:c5608950-5608546 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A6VBH9

Antitoxin

Source ID Structure
AlphaFold DB A0A140SDX7

References