Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2828297..2828633 | Replicon | chromosome |
| Accession | NZ_CP116571 | ||
| Organism | Enterococcus faecalis strain K190-1 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | E2Z0W4 |
| Locus tag | PML73_RS13975 | Protein ID | WP_002381035.1 |
| Coordinates | 2828297..2828440 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2828584..2828633 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML73_RS13955 | 2824389..2825027 | - | 639 | WP_271865427.1 | lytic polysaccharide monooxygenase | - |
| PML73_RS13960 | 2825713..2827329 | + | 1617 | WP_002389442.1 | phosphatase PAP2/LCP family protein | - |
| PML73_RS13965 | 2827658..2827807 | + | 150 | WP_002411240.1 | type I toxin-antitoxin system toxin PepG1 | - |
| PML73_RS13970 | 2827926..2828066 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
| PML73_RS13975 | 2828297..2828440 | + | 144 | WP_002381035.1 | putative holin-like toxin | Toxin |
| - | 2828584..2828633 | + | 50 | - | - | Antitoxin |
| PML73_RS13980 | 2828635..2832462 | - | 3828 | WP_010816211.1 | WxL domain-containing protein | - |
| PML73_RS13985 | 2832449..2832811 | - | 363 | WP_002378868.1 | LPXTG cell wall anchor domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5202.20 Da Isoelectric Point: 10.0041
>T269025 WP_002381035.1 NZ_CP116571:2828297-2828440 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT269025 NZ_CP116571:2828584-2828633 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|