Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 1014509..1015043 | Replicon | chromosome |
| Accession | NZ_CP116489 | ||
| Organism | Haemophilus influenzae strain 93P28H1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2R3GCN3 |
| Locus tag | BV189_RS05045 | Protein ID | WP_005651512.1 |
| Coordinates | 1014509..1014799 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | E7A5Y2 |
| Locus tag | BV189_RS05050 | Protein ID | WP_005651514.1 |
| Coordinates | 1014789..1015043 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BV189_RS05020 (BV189_1020) | 1011711..1012214 | + | 504 | WP_005659127.1 | LPS assembly lipoprotein LptE | - |
| BV189_RS05025 (BV189_1021) | 1012214..1013248 | + | 1035 | WP_005659128.1 | DNA polymerase III subunit delta | - |
| BV189_RS05030 (BV189_1022) | 1013427..1013729 | + | 303 | WP_272524418.1 | hypothetical protein | - |
| BV189_RS05035 (BV189_1023) | 1013912..1014049 | - | 138 | WP_005659136.1 | hypothetical protein | - |
| BV189_RS05040 (BV189_1025) | 1014219..1014473 | - | 255 | WP_014551014.1 | hypothetical protein | - |
| BV189_RS05045 (BV189_1026) | 1014509..1014799 | - | 291 | WP_005651512.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| BV189_RS05050 (BV189_1027) | 1014789..1015043 | - | 255 | WP_005651514.1 | stability protein StbD | Antitoxin |
| BV189_RS05055 (BV189_1028) | 1015341..1015565 | - | 225 | WP_005659141.1 | hypothetical protein | - |
| BV189_RS05060 (BV189_1029) | 1015565..1015873 | - | 309 | WP_005659142.1 | P2 family phage major capsid protein | - |
| BV189_RS05065 (BV189_1030) | 1015903..1016442 | - | 540 | WP_005659144.1 | hypothetical protein | - |
| BV189_RS05075 (BV189_1032) | 1016804..1018870 | - | 2067 | WP_005686190.1 | glycine--tRNA ligase subunit beta | - |
| BV189_RS05080 (BV189_1033) | 1019208..1019573 | - | 366 | WP_005686191.1 | endonuclease domain-containing protein | - |
| BV189_RS05085 (BV189_1034) | 1019603..1019863 | - | 261 | WP_005663579.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11482.41 Da Isoelectric Point: 10.6484
>T268775 WP_005651512.1 NZ_CP116489:c1014799-1014509 [Haemophilus influenzae]
MTYKLIFDKRALKEWNKLGETLRQQFKNKLAERMINPRIQADKLKGENDLYKIKLRSAGYRLVYQVRDQEITIIVVSVGK
RERLEVYKTAEQRTAH
MTYKLIFDKRALKEWNKLGETLRQQFKNKLAERMINPRIQADKLKGENDLYKIKLRSAGYRLVYQVRDQEITIIVVSVGK
RERLEVYKTAEQRTAH
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2R3GCN3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5C2QYX4 |