Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 2465854..2466653 | Replicon | chromosome |
| Accession | NZ_CP116480 | ||
| Organism | Escherichia coli strain GTEN_24 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | U9XVR9 |
| Locus tag | E5Q65_RS11920 | Protein ID | WP_000347267.1 |
| Coordinates | 2466189..2466653 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | E5Q65_RS11915 | Protein ID | WP_001307405.1 |
| Coordinates | 2465854..2466189 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5Q65_RS11900 (2461640) | 2461640..2462410 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| E5Q65_RS11905 (2462426) | 2462426..2463760 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| E5Q65_RS11910 (2464135) | 2464135..2465706 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| E5Q65_RS11915 (2465854) | 2465854..2466189 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| E5Q65_RS11920 (2466189) | 2466189..2466653 | + | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| E5Q65_RS11925 (2466708) | 2466708..2467517 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| E5Q65_RS11930 (2467766) | 2467766..2469046 | + | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| E5Q65_RS11935 (2469069) | 2469069..2469542 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| E5Q65_RS11940 (2469553) | 2469553..2470332 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| E5Q65_RS11945 (2470322) | 2470322..2471200 | + | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| E5Q65_RS11950 (2471218) | 2471218..2471652 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2455199..2466653 | 11454 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T268752 WP_000347267.1 NZ_CP116480:2466189-2466653 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XTR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |