Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 149337..150076 | Replicon | plasmid unnamed1 |
Accession | NZ_CP116348 | ||
Organism | Enterobacter ludwigii strain CM-TZ4 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | G8LQ82 |
Locus tag | PHA72_RS26270 | Protein ID | WP_014172305.1 |
Coordinates | 149591..150076 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | W7NLL2 |
Locus tag | PHA72_RS26265 | Protein ID | WP_014172304.1 |
Coordinates | 149337..149603 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PHA72_RS26245 (PHA72_26240) | 144887..145657 | + | 771 | WP_045343610.1 | TraX family protein | - |
PHA72_RS26250 (PHA72_26245) | 145672..145995 | + | 324 | WP_014172383.1 | hypothetical protein | - |
PHA72_RS26255 (PHA72_26250) | 145973..146776 | - | 804 | WP_041163021.1 | DUF4225 domain-containing protein | - |
PHA72_RS26260 (PHA72_26255) | 147666..148679 | - | 1014 | WP_014172302.1 | plasmid replication initiator RepA | - |
PHA72_RS26265 (PHA72_26260) | 149337..149603 | + | 267 | WP_014172304.1 | DUF1778 domain-containing protein | Antitoxin |
PHA72_RS26270 (PHA72_26265) | 149591..150076 | + | 486 | WP_014172305.1 | GNAT family N-acetyltransferase | Toxin |
PHA72_RS26275 (PHA72_26270) | 150250..151653 | + | 1404 | WP_000125668.1 | ISNCY family transposase | - |
PHA72_RS26280 (PHA72_26275) | 151686..152390 | - | 705 | WP_000130816.1 | arsenical resistance protein ArsH | - |
PHA72_RS26285 (PHA72_26280) | 152477..152797 | + | 321 | WP_000941305.1 | transcriptional regulator | - |
PHA72_RS26290 (PHA72_26285) | 152843..154132 | + | 1290 | WP_000922628.1 | arsenic transporter | - |
PHA72_RS26295 (PHA72_26290) | 154145..154570 | + | 426 | WP_000065802.1 | glutaredoxin-dependent arsenate reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | mcr-9 / aph(3'')-Ib / aph(6)-Id | - | 1..296144 | 296144 | |
- | flank | IS/Tn | - | - | 150250..151653 | 1403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17496.15 Da Isoelectric Point: 9.6039
>T268613 WP_014172305.1 NZ_CP116348:149591-150076 [Enterobacter ludwigii]
VGRVTAPEPLSSSHQMAEFVSGEAVLDDWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHVEATGSLRRNM
PDPIPVIILARLAIDASFRGQGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYLHHGFKASQTQERTLFLKLP
Q
VGRVTAPEPLSSSHQMAEFVSGEAVLDDWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHVEATGSLRRNM
PDPIPVIILARLAIDASFRGQGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYLHHGFKASQTQERTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|