Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 99594..100237 Replicon plasmid unnamed1
Accession NZ_CP116348
Organism Enterobacter ludwigii strain CM-TZ4

Toxin (Protein)


Gene name vagD Uniprot ID A0A6C0NGR2
Locus tag PHA72_RS26015 Protein ID WP_008322222.1
Coordinates 99821..100237 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A6C0NE67
Locus tag PHA72_RS26010 Protein ID WP_008322219.1
Coordinates 99594..99824 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PHA72_RS25975 (PHA72_25970) 94734..95663 + 930 WP_045334613.1 copper resistance inner membrane protein PcoD -
PHA72_RS25980 (PHA72_25975) 95718..96398 + 681 WP_045334614.1 copper response regulator transcription factor PcoR -
PHA72_RS25985 (PHA72_25980) 96395..97795 + 1401 WP_059305919.1 copper resistance membrane spanning protein PcoS -
PHA72_RS25990 (PHA72_25985) 98012..98446 + 435 WP_004152085.1 copper resistance system metallochaperone PcoE -
PHA72_RS25995 (PHA72_25990) 98678..98974 - 297 WP_045343599.1 type II toxin-antitoxin system RelE/ParE family toxin -
PHA72_RS26000 (PHA72_25995) 98961..99221 - 261 WP_040219223.1 type II toxin-antitoxin system ParD family antitoxin -
PHA72_RS26005 (PHA72_26000) 99345..99470 - 126 Protein_97 hypothetical protein -
PHA72_RS26010 (PHA72_26005) 99594..99824 + 231 WP_008322219.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PHA72_RS26015 (PHA72_26010) 99821..100237 + 417 WP_008322222.1 type II toxin-antitoxin system VapC family toxin Toxin
PHA72_RS26020 (PHA72_26015) 100311..101873 + 1563 WP_008322224.1 AAA family ATPase -
PHA72_RS26025 (PHA72_26020) 101858..102880 + 1023 WP_008322227.1 helicase UvrD -
PHA72_RS26030 (PHA72_26025) 103678..104154 - 477 Protein_102 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-9 / aph(3'')-Ib / aph(6)-Id - 1..296144 296144


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15188.56 Da        Isoelectric Point: 7.1361

>T268612 WP_008322222.1 NZ_CP116348:99821-100237 [Enterobacter ludwigii]
VNKTYMLDTNICSFIMREQPEAVLKRLEQAVLRNQRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8736.84 Da        Isoelectric Point: 4.4692

>AT268612 WP_008322219.1 NZ_CP116348:99594-99824 [Enterobacter ludwigii]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVTDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0NGR2

Antitoxin

Source ID Structure
AlphaFold DB A0A6C0NE67

References