Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 483320..483836 | Replicon | chromosome |
| Accession | NZ_CP116347 | ||
| Organism | Enterobacter ludwigii strain CM-TZ4 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PHA72_RS02305 | Protein ID | WP_059306429.1 |
| Coordinates | 483552..483836 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A839BTQ9 |
| Locus tag | PHA72_RS02300 | Protein ID | WP_020885404.1 |
| Coordinates | 483320..483562 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA72_RS02285 (PHA72_02285) | 479317..480057 | + | 741 | WP_059306432.1 | KDGP aldolase family protein | - |
| PHA72_RS02290 (PHA72_02290) | 480176..481312 | + | 1137 | WP_059306431.1 | lactonase family protein | - |
| PHA72_RS02295 (PHA72_02295) | 481332..483242 | + | 1911 | WP_059306430.1 | PRD domain-containing protein | - |
| PHA72_RS02300 (PHA72_02300) | 483320..483562 | + | 243 | WP_020885404.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PHA72_RS02305 (PHA72_02305) | 483552..483836 | + | 285 | WP_059306429.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PHA72_RS02310 (PHA72_02310) | 483840..484304 | - | 465 | WP_059306428.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PHA72_RS02315 (PHA72_02315) | 484443..486581 | - | 2139 | WP_059306427.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PHA72_RS02320 (PHA72_02320) | 486949..487521 | - | 573 | WP_059306426.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10950.73 Da Isoelectric Point: 10.1619
>T268605 WP_059306429.1 NZ_CP116347:483552-483836 [Enterobacter ludwigii]
MTYELVFDPRAFKEWTRLGDTVKNQFKKKLANVLVNPWVESARLHGLPDCDKIKLRSQGYRLVYQVQDNVVTVCVITIGK
REKSAVYHDANKRL
MTYELVFDPRAFKEWTRLGDTVKNQFKKKLANVLVNPWVESARLHGLPDCDKIKLRSQGYRLVYQVQDNVVTVCVITIGK
REKSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|