Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1734386..1734973 | Replicon | chromosome |
| Accession | NZ_CP116303 | ||
| Organism | Tenacibaculum finnmarkense strain 20-4106-2 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | PJH08_RS07540 | Protein ID | WP_271402616.1 |
| Coordinates | 1734386..1734685 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PJH08_RS07545 | Protein ID | WP_101902711.1 |
| Coordinates | 1734689..1734973 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PJH08_RS07520 (PJH08_07520) | 1729564..1729956 | + | 393 | WP_101915088.1 | helix-turn-helix domain-containing protein | - |
| PJH08_RS07525 (PJH08_07525) | 1729971..1730819 | + | 849 | WP_233885030.1 | IS3 family transposase | - |
| PJH08_RS07530 (PJH08_07530) | 1730870..1731625 | + | 756 | WP_271402615.1 | hypothetical protein | - |
| PJH08_RS07535 (PJH08_07535) | 1731781..1732389 | + | 609 | WP_232125636.1 | SMI1/KNR4 family protein | - |
| PJH08_RS07540 (PJH08_07540) | 1734386..1734685 | + | 300 | WP_271402616.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PJH08_RS07545 (PJH08_07545) | 1734689..1734973 | + | 285 | WP_101902711.1 | putative addiction module antidote protein | Antitoxin |
| PJH08_RS07550 (PJH08_07550) | 1735856..1736248 | + | 393 | WP_101915088.1 | helix-turn-helix domain-containing protein | - |
| PJH08_RS07555 (PJH08_07555) | 1736263..1737111 | + | 849 | WP_233885030.1 | IS3 family transposase | - |
| PJH08_RS07560 (PJH08_07560) | 1737174..1737656 | + | 483 | WP_239780262.1 | toll/interleukin-1 receptor domain-containing protein | - |
| PJH08_RS07565 (PJH08_07565) | 1737669..1738214 | + | 546 | WP_101955226.1 | TIR domain-containing protein | - |
| PJH08_RS07570 (PJH08_07570) | 1738201..1738869 | + | 669 | WP_101955225.1 | hypothetical protein | - |
| PJH08_RS07575 (PJH08_07575) | 1739089..1739817 | + | 729 | WP_271402617.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11762.92 Da Isoelectric Point: 10.4596
>T268576 WP_271402616.1 NZ_CP116303:1734386-1734685 [Tenacibaculum finnmarkense]
MFFIEKTTEFDKWLKKLKDFKAKAKILFRIQKLESDEHFGDCKTVGDGIREMRINFAKGYRIYFKEKDGKIIILLIGGDK
STQQKDITKAKEIWKKLNK
MFFIEKTTEFDKWLKKLKDFKAKAKILFRIQKLESDEHFGDCKTVGDGIREMRINFAKGYRIYFKEKDGKIIILLIGGDK
STQQKDITKAKEIWKKLNK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|