Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 606020..606699 Replicon chromosome
Accession NZ_CP116249
Organism Enterobacter roggenkampii strain 120063

Toxin (Protein)


Gene name ykfI Uniprot ID R8WLP2
Locus tag KK030_RS02960 Protein ID WP_006812012.1
Coordinates 606358..606699 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID R8WMM2
Locus tag KK030_RS02955 Protein ID WP_006812013.1
Coordinates 606020..606337 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KK030_RS02910 (KK030_02905) 601457..602278 + 822 WP_001548153.1 DUF932 domain-containing protein -
KK030_RS02915 (KK030_02910) 602495..603196 + 702 WP_001581462.1 WYL domain-containing protein -
KK030_RS02920 (KK030_02915) 603237..603473 + 237 WP_214574957.1 protein YpjK -
KK030_RS02925 (KK030_02920) 603473..603916 + 444 WP_001547764.1 lipoprotein YafY -
KK030_RS02930 (KK030_02925) 603939..604406 + 468 WP_001547765.1 protein YkfB -
KK030_RS02935 (KK030_02930) 604483..604722 + 240 WP_180208556.1 DUF905 domain-containing protein -
KK030_RS02940 (KK030_02935) 604820..605278 + 459 WP_000211838.1 antirestriction protein -
KK030_RS02945 (KK030_02940) 605294..605770 + 477 WP_000811693.1 RadC family protein -
KK030_RS02950 (KK030_02945) 605779..606000 + 222 WP_001548171.1 DUF987 domain-containing protein -
KK030_RS02955 (KK030_02950) 606020..606337 + 318 WP_006812013.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
KK030_RS02960 (KK030_02955) 606358..606699 + 342 WP_006812012.1 TA system toxin CbtA family protein Toxin
KK030_RS02965 (KK030_02960) 606979..608040 - 1062 WP_214574532.1 tyrosine-type recombinase/integrase -
KK030_RS02970 (KK030_02965) 608040..608633 - 594 WP_214574533.1 phage repressor protein CI -
KK030_RS02975 (KK030_02970) 608741..608962 + 222 WP_045142907.1 hypothetical protein -
KK030_RS02980 (KK030_02975) 608993..609496 + 504 WP_214574534.1 phage regulatory CII family protein -
KK030_RS02985 (KK030_02980) 609512..609730 + 219 WP_214574572.1 DUF2724 domain-containing protein -
KK030_RS02990 (KK030_02985) 609720..610160 + 441 WP_214574535.1 hypothetical protein -
KK030_RS02995 (KK030_02990) 610157..610558 + 402 WP_214574536.1 hypothetical protein -
KK030_RS03000 (KK030_02995) 610682..610858 + 177 WP_250902626.1 DUF2732 family protein -
KK030_RS03005 (KK030_03000) 610849..611556 + 708 WP_250902622.1 3'-5' exonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(5-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12989.07 Da        Isoelectric Point: 10.4476

>T268549 WP_006812012.1 NZ_CP116249:606358-606699 [Enterobacter roggenkampii]
MKTLPATTQRAAKPCLAPVAVWQMLLTRLLKQHYGLTLNDTPFSEERVIQEHIDAGITLADAVNFLVEKYELVRIDRKGF
NWQEQSPYLRAVDILRARQATGLLRQSRKNSVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11874.45 Da        Isoelectric Point: 7.0166

>AT268549 WP_006812013.1 NZ_CP116249:606020-606337 [Enterobacter roggenkampii]
MTHINWGLQRAITPRLGARLVQEGNRLHYLADRASITGRFSDTECRKLDETCPHFIRQMESMLTTGELSPQHAHCVTLYH
NGFTCEADTLGSCGYVYIAIYPTQS

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R8WLP2

Antitoxin

Source ID Structure
AlphaFold DB R8WMM2

References