Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2050056..2050649 | Replicon | chromosome |
Accession | NZ_CP116246 | ||
Organism | Desulfovibrio vulgaris strain L2 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q72BA7 |
Locus tag | PH214_RS09230 | Protein ID | WP_010939017.1 |
Coordinates | 2050371..2050649 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PH214_RS09225 | Protein ID | WP_010939018.1 |
Coordinates | 2050056..2050361 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PH214_RS09215 (PH214_09215) | 2045314..2046222 | - | 909 | WP_271370175.1 | type II CRISPR-associated endonuclease Cas1 | - |
PH214_RS09220 (PH214_09220) | 2046234..2049428 | - | 3195 | WP_271370176.1 | type II CRISPR RNA-guided endonuclease Cas9 | - |
PH214_RS09225 (PH214_09225) | 2050056..2050361 | - | 306 | WP_010939018.1 | HigA family addiction module antitoxin | Antitoxin |
PH214_RS09230 (PH214_09230) | 2050371..2050649 | - | 279 | WP_010939017.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PH214_RS09235 (PH214_09235) | 2050920..2051336 | + | 417 | WP_271370177.1 | structural protein | - |
PH214_RS09240 (PH214_09240) | 2051336..2051686 | + | 351 | WP_271370178.1 | hypothetical protein | - |
PH214_RS09245 (PH214_09245) | 2051683..2051931 | + | 249 | WP_271370179.1 | hypothetical protein | - |
PH214_RS09250 (PH214_09250) | 2052067..2052675 | + | 609 | WP_271370180.1 | hypothetical protein | - |
PH214_RS09255 (PH214_09255) | 2052662..2054266 | + | 1605 | WP_271370181.1 | hypothetical protein | - |
PH214_RS09260 (PH214_09260) | 2054263..2054817 | + | 555 | WP_271370182.1 | hypothetical protein | - |
PH214_RS09265 (PH214_09265) | 2054814..2055155 | + | 342 | WP_271370183.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10558.00 Da Isoelectric Point: 7.8928
>T268546 WP_010939017.1 NZ_CP116246:c2050649-2050371 [Desulfovibrio vulgaris]
MIASFRCKETRSLFDGGTSRRFQAFSAVALRKLDMLDAAVSLDDLRIPPANRLEALKGDRQGQHSIRINDQWRVCFVWRD
GAPHDVEIVDYH
MIASFRCKETRSLFDGGTSRRFQAFSAVALRKLDMLDAAVSLDDLRIPPANRLEALKGDRQGQHSIRINDQWRVCFVWRD
GAPHDVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|