Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4030646..4031300 | Replicon | chromosome |
| Accession | NZ_CP116241 | ||
| Organism | Escherichia coli strain 7.1994/NIST0056 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | PH192_RS19575 | Protein ID | WP_000244777.1 |
| Coordinates | 4030893..4031300 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PH192_RS19570 | Protein ID | WP_000354046.1 |
| Coordinates | 4030646..4030912 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH192_RS19545 (4025815) | 4025815..4026558 | + | 744 | WP_271356447.1 | SDR family oxidoreductase | - |
| PH192_RS19550 (4026615) | 4026615..4028048 | - | 1434 | WP_001307385.1 | 6-phospho-beta-glucosidase BglA | - |
| PH192_RS19555 (4028093) | 4028093..4028404 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| PH192_RS19560 (4028568) | 4028568..4029227 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| PH192_RS19565 (4029423) | 4029423..4030403 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| PH192_RS19570 (4030646) | 4030646..4030912 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PH192_RS19575 (4030893) | 4030893..4031300 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
| PH192_RS19580 (4031340) | 4031340..4031861 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| PH192_RS19585 (4031973) | 4031973..4032869 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PH192_RS19590 (4032894) | 4032894..4033604 | + | 711 | WP_000715208.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PH192_RS19595 (4033610) | 4033610..4035343 | + | 1734 | WP_000813215.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T268525 WP_000244777.1 NZ_CP116241:4030893-4031300 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |