Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2688763..2689561 Replicon chromosome
Accession NZ_CP116241
Organism Escherichia coli strain 7.1994/NIST0056

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag PH192_RS13130 Protein ID WP_000854735.1
Coordinates 2689184..2689561 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A067H947
Locus tag PH192_RS13125 Protein ID WP_001285415.1
Coordinates 2688763..2689137 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PH192_RS13080 (2683854) 2683854..2684536 + 683 Protein_2565 IS66-like element accessory protein TnpA -
PH192_RS13085 (2684536) 2684536..2684883 + 348 WP_211140355.1 IS66 family insertion sequence element accessory protein TnpB -
PH192_RS13090 (2685071) 2685071..2685610 + 540 WP_271356484.1 IS66 family transposase zinc-finger binding domain-containing protein -
PH192_RS13095 (2685510) 2685510..2686346 + 837 Protein_2568 IS66 family transposase -
PH192_RS13100 (2686368) 2686368..2686475 + 108 WP_032282290.1 transposase domain-containing protein -
PH192_RS13105 (2686528) 2686528..2687346 + 819 WP_001175148.1 DUF932 domain-containing protein -
PH192_RS13110 (2687428) 2687428..2687907 + 480 WP_120136233.1 antirestriction protein -
PH192_RS13115 (2687923) 2687923..2688399 + 477 WP_001366855.1 RadC family protein -
PH192_RS13120 (2688462) 2688462..2688683 + 222 WP_000692309.1 DUF987 domain-containing protein -
PH192_RS13125 (2688763) 2688763..2689137 + 375 WP_001285415.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PH192_RS13130 (2689184) 2689184..2689561 + 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
PH192_RS13135 (2689558) 2689558..2690046 + 489 WP_000761677.1 DUF5983 family protein -
PH192_RS13140 (2690058) 2690058..2690255 + 198 WP_000839291.1 DUF957 domain-containing protein -
PH192_RS13145 (2690340) 2690340..2691206 + 867 WP_001280433.1 DUF4942 domain-containing protein -
PH192_RS13150 (2691278) 2691278..2691541 + 264 WP_025492088.1 type II toxin-antitoxin system ParD family antitoxin -
PH192_RS13155 (2691538) 2691538..2691864 + 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
PH192_RS13160 (2692747) 2692747..2694285 + 1539 WP_001187200.1 lysine decarboxylation/transport transcriptional activator CadC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2629727..2702097 72370


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T268512 WP_000854735.1 NZ_CP116241:2689184-2689561 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13663.32 Da        Isoelectric Point: 5.8640

>AT268512 WP_001285415.1 NZ_CP116241:2688763-2689137 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A0A067H947

References