Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 58329..58972 Replicon plasmid pDETEC81
Accession NZ_CP116170
Organism Escherichia coli strain DETEC-P1056

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag PIC86_RS23555 Protein ID WP_063073410.1
Coordinates 58556..58972 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A3Q0N5I0
Locus tag PIC86_RS23550 Protein ID WP_063073411.1
Coordinates 58329..58559 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC86_RS23510 (53398) 53398..53790 - 393 WP_063073471.1 plasmid partitioning/stability family protein -
PIC86_RS23515 (53795) 53795..54766 - 972 WP_001103690.1 plasmid segregation protein ParM -
PIC86_RS23520 (54995) 54995..55639 + 645 WP_000633913.1 division plane positioning ATPase MipZ -
PIC86_RS23525 (55633) 55633..55908 + 276 WP_050858693.1 hypothetical protein -
PIC86_RS23530 (56060) 56060..56851 - 792 WP_000016494.1 site-specific integrase -
PIC86_RS23535 (56848) 56848..57354 - 507 WP_001505085.1 hypothetical protein -
PIC86_RS23540 (57345) 57345..58049 + 705 WP_001775011.1 IS6-like element IS26 family transposase -
PIC86_RS23545 (58196) 58196..58372 - 177 Protein_77 hypothetical protein -
PIC86_RS23550 (58329) 58329..58559 + 231 WP_063073411.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PIC86_RS23555 (58556) 58556..58972 + 417 WP_063073410.1 type II toxin-antitoxin system VapC family toxin Toxin
PIC86_RS23560 (59046) 59046..60608 + 1563 WP_063073409.1 AAA family ATPase -
PIC86_RS23565 (60593) 60593..61615 + 1023 WP_063073408.1 hypothetical protein -
PIC86_RS23570 (61902) 61902..62132 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin -
PIC86_RS23575 (62129) 62129..62224 + 96 Protein_83 VapC toxin family PIN domain ribonuclease -
PIC86_RS23580 (62283) 62283..63067 - 785 Protein_84 IS21-like element helper ATPase IstB -
PIC86_RS23585 (63067) 63067..63720 - 654 Protein_85 IS21-like element IS21 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..90243 90243
- inside IScluster/Tn - - 57345..63708 6363


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-51)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15167.53 Da        Isoelectric Point: 7.8882

>T268282 WP_063073410.1 NZ_CP116170:58556-58972 [Escherichia coli]
VNKTYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCTRLDAILPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHSIAAGAVLVTNNTREFERVPGLVLEDWIR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8688.84 Da        Isoelectric Point: 4.6310

>AT268282 WP_063073411.1 NZ_CP116170:58329-58559 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAKLEKADPDFMAEREDVVTDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A3Q0N5I0

References