Detailed information of TA system TA268279

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 37446..37872
• Replicon: plasmid pDETEC81
• Accession: NZ_CP116170
• Organism: Escherichia coli strain DETEC-P1056

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIC86_RS23385
• Protein ID: WP_001372321.1
• Coordinates: 37446..37571 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	37648..37872 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIC86_RS23340 (32494)	32494..32721	-	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-
PIC86_RS23345 (32816)	32816..33502	-	687	WP_015059009.1	PAS domain-containing protein	-
PIC86_RS23350 (33693)	33693..34076	-	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIC86_RS23355 (34353)	34353..35000	+	648	WP_148726238.1	transglycosylase SLT domain-containing protein	-
PIC86_RS23360 (35297)	35297..36118	-	822	WP_033804334.1	DUF932 domain-containing protein	-
PIC86_RS23365 (36237)	36237..36524	-	288	WP_000107535.1	hypothetical protein	-
PIC86_RS23370 (36549)	36549..36755	-	207	WP_033804333.1	hypothetical protein	-
PIC86_RS23375 (36825)	36825..36998	+	174	Protein_43	hypothetical protein	-
PIC86_RS23380 (36996)	36996..37226	-	231	WP_071845785.1	hypothetical protein	-
PIC86_RS23385 (37446)	37446..37571	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIC86_RS23390 (37513)	37513..37662	-	150	Protein_46	plasmid maintenance protein Mok	-
- (37648)	37648..37872	-	225	NuclAT_0	-	Antitoxin
- (37648)	37648..37872	-	225	NuclAT_0	-	Antitoxin
- (37648)	37648..37872	-	225	NuclAT_0	-	Antitoxin
- (37648)	37648..37872	-	225	NuclAT_0	-	Antitoxin
PIC86_RS23395 (37841)	37841..38603	-	763	Protein_47	plasmid SOS inhibition protein A	-
PIC86_RS23400 (38600)	38600..39034	-	435	WP_000845907.1	conjugation system SOS inhibitor PsiB	-
PIC86_RS23405 (39089)	39089..41047	-	1959	WP_063072993.1	ParB/RepB/Spo0J family partition protein	-
PIC86_RS23410 (41112)	41112..41345	-	234	WP_000006030.1	DUF905 family protein	-
PIC86_RS23415 (41407)	41407..41859	-	453	WP_000290842.1	single-stranded DNA-binding protein	-
PIC86_RS23420 (41885)	41885..42091	-	207	WP_000275853.1	hypothetical protein	-
PIC86_RS23425 (42332)	42332..42601	-	270	WP_071977877.1	hypothetical protein	-
PIC86_RS23430 (42502)	42502..42726	-	225	WP_016238251.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..90243	90243

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T268279 WP_001372321.1 NZ_CP116170:c37571-37446 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT268279 NZ_CP116170:c37872-37648 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGACAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin