Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 56735..56989 Replicon plasmid pDETEC2
Accession NZ_CP116168
Organism Escherichia coli strain DETEC-P169

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag PID12_RS24150 Protein ID WP_001312851.1
Coordinates 56735..56884 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 56928..56989 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PID12_RS24120 (51982) 51982..52893 - 912 WP_000440183.1 carbamate kinase -
PID12_RS24125 (52904) 52904..54124 - 1221 WP_000410951.1 arginine deiminase -
PID12_RS24130 (54831) 54831..55445 + 615 Protein_61 VENN motif pre-toxin domain-containing protein -
PID12_RS24135 (55445) 55445..55891 - 447 Protein_62 plasmid replication initiator RepA -
PID12_RS24140 (55884) 55884..55958 - 75 WP_032336874.1 RepA leader peptide Tap -
PID12_RS24145 (56194) 56194..56451 - 258 WP_000083833.1 replication regulatory protein RepA -
PID12_RS24150 (56735) 56735..56884 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (56928) 56928..56989 + 62 NuclAT_2 - Antitoxin
- (56928) 56928..56989 + 62 NuclAT_2 - Antitoxin
- (56928) 56928..56989 + 62 NuclAT_2 - Antitoxin
- (56928) 56928..56989 + 62 NuclAT_2 - Antitoxin
PID12_RS24155 (57128) 57128..57310 - 183 WP_000968309.1 hypothetical protein -
PID12_RS24160 (57411) 57411..58027 + 617 Protein_67 IS1-like element IS1A family transposase -
PID12_RS24165 (58107) 58107..60128 - 2022 Protein_68 conjugative relaxase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(A) / aac(3)-IIa / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / tet(A) / sitABCD iutA / iucD / iucC / iucB / iucA 1..113066 113066
- flank IS/Tn - - 57605..58120 515


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T268249 WP_001312851.1 NZ_CP116168:c56884-56735 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT268249 NZ_CP116168:56928-56989 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References