Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4506705..4507537 | Replicon | chromosome |
| Accession | NZ_CP116123 | ||
| Organism | Escherichia coli strain DETEC-P666 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | PIB57_RS21475 | Protein ID | WP_000854753.1 |
| Coordinates | 4507163..4507537 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NQ68 |
| Locus tag | PIB57_RS21470 | Protein ID | WP_001540478.1 |
| Coordinates | 4506705..4507073 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB57_RS21435 (4502537) | 4502537..4503217 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| PIB57_RS21440 (4503365) | 4503365..4504042 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| PIB57_RS21445 (4504048) | 4504048..4504281 | + | 234 | WP_001278283.1 | DUF905 family protein | - |
| PIB57_RS21450 (4504371) | 4504371..4505189 | + | 819 | WP_023909075.1 | DUF932 domain-containing protein | - |
| PIB57_RS21455 (4505281) | 4505281..4505766 | + | 486 | WP_001586019.1 | antirestriction protein | - |
| PIB57_RS21460 (4505782) | 4505782..4506258 | + | 477 | WP_001186773.1 | RadC family protein | - |
| PIB57_RS21465 (4506321) | 4506321..4506542 | + | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
| PIB57_RS21470 (4506705) | 4506705..4507073 | + | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PIB57_RS21475 (4507163) | 4507163..4507537 | + | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| PIB57_RS21480 (4507534) | 4507534..4508022 | + | 489 | WP_000777545.1 | DUF5983 family protein | - |
| PIB57_RS21485 (4508034) | 4508034..4508231 | + | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| PIB57_RS21490 (4508328) | 4508328..4508897 | + | 570 | WP_001290252.1 | DUF4942 domain-containing protein | - |
| PIB57_RS21495 (4509646) | 4509646..4511184 | + | 1539 | WP_001187178.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4494588..4518997 | 24409 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T268105 WP_000854753.1 NZ_CP116123:4507163-4507537 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT268105 WP_001540478.1 NZ_CP116123:4506705-4507073 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NQ68 |