Detailed information of TA system TA268050

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 63202..63471
• Replicon: plasmid pDETEC21
• Accession: NZ_CP116113
• Organism: Escherichia coli strain DETEC-P80

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIC84_RS24885
• Protein ID: WP_001372321.1
• Coordinates: 63346..63471 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	63202..63267 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIC84_RS24850	58912..59439	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
PIC84_RS24855	59497..59730	+	234	WP_000006003.1	DUF905 family protein	-
PIC84_RS24860	59791..61814	+	2024	Protein_76	ParB/RepB/Spo0J family partition protein	-
PIC84_RS24865	61883..62317	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
PIC84_RS24870	62314..63076	+	763	Protein_78	plasmid SOS inhibition protein A	-
-	63045..63269	+	225	NuclAT_0	-	-
-	63045..63269	+	225	NuclAT_0	-	-
-	63045..63269	+	225	NuclAT_0	-	-
-	63045..63269	+	225	NuclAT_0	-	-
PIC84_RS24875	63054..63233	-	180	WP_001309233.1	hypothetical protein	-
-	63202..63267	-	66	-	-	Antitoxin
PIC84_RS24880	63255..63404	+	150	Protein_80	plasmid maintenance protein Mok	-
PIC84_RS24885	63346..63471	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIC84_RS24890	63790..64086	-	297	Protein_82	hypothetical protein	-
PIC84_RS24895	64386..64682	+	297	WP_001272251.1	hypothetical protein	-
PIC84_RS24900	64793..65614	+	822	WP_001234445.1	DUF932 domain-containing protein	-
PIC84_RS24905	65911..66558	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
PIC84_RS24910	66835..67218	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIC84_RS24915	67409..68095	+	687	WP_015059009.1	PAS domain-containing protein	-
PIC84_RS24920	68189..68416	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	fosA3 / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / rmtB / blaTEM-1B / blaCTX-M-55	-	1..103125	103125

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T268050 WP_001372321.1 NZ_CP116113:63346-63471 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT268050 NZ_CP116113:c63267-63202 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin