Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 7747..8390 Replicon plasmid pDETEC21
Accession NZ_CP116113
Organism Escherichia coli strain DETEC-P80

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag PIC84_RS24540 Protein ID WP_001044768.1
Coordinates 7974..8390 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag PIC84_RS24535 Protein ID WP_001261287.1
Coordinates 7747..7977 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC84_RS24505 (3074) 3074..4273 - 1200 WP_000948429.1 IS91 family transposase -
PIC84_RS24510 (4283) 4283..4471 - 189 WP_000957857.1 hypothetical protein -
PIC84_RS24515 (4486) 4486..4722 - 237 WP_272756116.1 hypothetical protein -
PIC84_RS24520 (4642) 4642..6222 + 1581 WP_269516186.1 P-loop NTPase fold protein -
PIC84_RS24525 (6272) 6272..7171 - 900 WP_000963206.1 nucleotide-binding protein -
PIC84_RS24530 (7161) 7161..7451 - 291 WP_000111771.1 hypothetical protein -
PIC84_RS24535 (7747) 7747..7977 + 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PIC84_RS24540 (7974) 7974..8390 + 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
PIC84_RS24545 (8552) 8552..10690 - 2139 WP_000350638.1 AAA family ATPase -
PIC84_RS24550 (11044) 11044..11301 + 258 WP_000343085.1 hypothetical protein -
PIC84_RS24555 (11301) 11301..11891 + 591 WP_000194575.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid fosA3 / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / rmtB / blaTEM-1B / blaCTX-M-55 - 1..103125 103125
- flank IS/Tn - - 3074..4273 1199


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T268049 WP_001044768.1 NZ_CP116113:7974-8390 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT268049 WP_001261287.1 NZ_CP116113:7747-7977 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References