Detailed information of TA system TA267956

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 32678..32947
• Replicon: plasmid pDETEC24
• Accession: NZ_CP116102
• Organism: Escherichia coli strain DETEC-P881

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIC52_RS23865
• Protein ID: WP_001372321.1
• Coordinates: 32822..32947 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	32678..32743 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIC52_RS23830	28388..28915	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
PIC52_RS23835	28973..29206	+	234	WP_000006003.1	DUF905 family protein	-
PIC52_RS23840	29267..31290	+	2024	Protein_41	ParB/RepB/Spo0J family partition protein	-
PIC52_RS23845	31359..31793	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
PIC52_RS23850	31790..32552	+	763	Protein_43	plasmid SOS inhibition protein A	-
-	32521..32745	+	225	NuclAT_0	-	-
-	32521..32745	+	225	NuclAT_0	-	-
-	32521..32745	+	225	NuclAT_0	-	-
-	32521..32745	+	225	NuclAT_0	-	-
PIC52_RS23855	32530..32709	-	180	WP_001309233.1	hypothetical protein	-
-	32678..32743	-	66	-	-	Antitoxin
PIC52_RS23860	32731..32880	+	150	Protein_45	plasmid maintenance protein Mok	-
PIC52_RS23865	32822..32947	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIC52_RS23870	33266..33562	-	297	Protein_47	hypothetical protein	-
PIC52_RS23875	33862..34158	+	297	WP_001272251.1	hypothetical protein	-
PIC52_RS23880	34269..35090	+	822	WP_001234445.1	DUF932 domain-containing protein	-
PIC52_RS23885	35387..35989	-	603	WP_000243713.1	transglycosylase SLT domain-containing protein	-
PIC52_RS23890	36310..36693	+	384	WP_053320747.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIC52_RS23895	36880..37569	+	690	WP_000283380.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T267956 WP_001372321.1 NZ_CP116102:32822-32947 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT267956 NZ_CP116102:c32743-32678 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin