Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3183554..3183810 | Replicon | chromosome |
| Accession | NZ_CP116100 | ||
| Organism | Escherichia coli strain DETEC-P881 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | F4T5C6 |
| Locus tag | PIC52_RS15350 | Protein ID | WP_001135731.1 |
| Coordinates | 3183658..3183810 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 3183554..3183608 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC52_RS15330 | 3178782..3179777 | - | 996 | WP_001606408.1 | O-acetyltransferase WecH | - |
| PIC52_RS15335 | 3179952..3180251 | + | 300 | WP_000980102.1 | YsaB family lipoprotein | - |
| PIC52_RS15340 | 3180346..3181257 | + | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| PIC52_RS15345 | 3181267..3183336 | + | 2070 | WP_001291788.1 | glycine--tRNA ligase subunit beta | - |
| - | 3183554..3183608 | - | 55 | - | - | Antitoxin |
| PIC52_RS15350 | 3183658..3183810 | + | 153 | WP_001135731.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| PIC52_RS15355 | 3183787..3183858 | - | 72 | WP_212734107.1 | hypothetical protein | - |
| PIC52_RS15360 | 3183998..3184210 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| PIC52_RS15365 | 3184491..3184781 | - | 291 | WP_000455798.1 | HTH-type transcriptional regulator | - |
| PIC52_RS15370 | 3185215..3185925 | + | 711 | WP_000190516.1 | DUF3053 domain-containing protein | - |
| PIC52_RS15375 | 3185975..3186949 | - | 975 | WP_001606406.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| PIC52_RS15380 | 3187053..3187712 | - | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 6025.30 Da Isoelectric Point: 7.7169
>T267942 WP_001135731.1 NZ_CP116100:3183658-3183810 [Escherichia coli]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
Download Length: 153 bp
Antitoxin
Download Length: 55 bp
>AT267942 NZ_CP116100:c3183608-3183554 [Escherichia coli]
GTTCAAGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAAGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|