Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2119537..2119795 | Replicon | chromosome |
| Accession | NZ_CP116100 | ||
| Organism | Escherichia coli strain DETEC-P881 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | PIC52_RS10385 | Protein ID | WP_000809168.1 |
| Coordinates | 2119643..2119795 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 2119537..2119594 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC52_RS10370 | 2115365..2116624 | - | 1260 | WP_001606794.1 | hypothetical protein | - |
| PIC52_RS10375 | 2116753..2118246 | - | 1494 | WP_001173016.1 | sulfatase-like hydrolase/transferase | - |
| PIC52_RS10380 | 2118267..2119028 | - | 762 | WP_001274833.1 | outer membrane protein OmpK | - |
| - | 2119537..2119594 | - | 58 | - | - | Antitoxin |
| PIC52_RS10385 | 2119643..2119795 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| PIC52_RS10390 | 2119899..2121029 | - | 1131 | WP_001118473.1 | molecular chaperone DnaJ | - |
| PIC52_RS10395 | 2121118..2123034 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| PIC52_RS10400 | 2123406..2123810 | + | 405 | WP_001606793.1 | DUF2541 family protein | - |
| PIC52_RS10405 | 2123836..2124549 | + | 714 | WP_001102393.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T267939 WP_000809168.1 NZ_CP116100:2119643-2119795 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT267939 NZ_CP116100:c2119594-2119537 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|