Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hokW-rdlD/- |
| Location | 2047878..2048103 | Replicon | chromosome |
| Accession | NZ_CP116071 | ||
| Organism | Escherichia coli strain DETEC-S589 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | PIC30_RS09720 | Protein ID | WP_000813254.1 |
| Coordinates | 2047948..2048103 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2047878..2047936 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC30_RS09675 | 2043140..2043292 | - | 153 | WP_000379609.1 | DUF1391 family protein | - |
| PIC30_RS09680 | 2043564..2043851 | - | 288 | WP_000936799.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PIC30_RS09685 | 2043851..2044042 | - | 192 | WP_000100899.1 | hypothetical protein | - |
| PIC30_RS09690 | 2044070..2044471 | - | 402 | WP_001329851.1 | helix-turn-helix domain-containing protein | - |
| PIC30_RS09695 | 2044581..2044853 | + | 273 | WP_000887447.1 | YdaS family helix-turn-helix protein | - |
| PIC30_RS09700 | 2044837..2045262 | + | 426 | WP_000693918.1 | toxin YdaT family protein | - |
| PIC30_RS09705 | 2045334..2046404 | + | 1071 | WP_001262355.1 | hypothetical protein | - |
| PIC30_RS09710 | 2046445..2046870 | + | 426 | WP_001151152.1 | DUF977 family protein | - |
| PIC30_RS09715 | 2047045..2047710 | + | 666 | WP_000150294.1 | epoxyqueuosine reductase QueH | - |
| - | 2047878..2047936 | - | 59 | - | - | Antitoxin |
| PIC30_RS09720 | 2047948..2048103 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| PIC30_RS09725 | 2048271..2048549 | + | 279 | WP_024193993.1 | hypothetical protein | - |
| PIC30_RS09730 | 2048551..2049600 | + | 1050 | WP_001265292.1 | DUF968 domain-containing protein | - |
| PIC30_RS09735 | 2049613..2049987 | + | 375 | WP_001217427.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PIC30_RS09740 | 2049984..2050805 | + | 822 | WP_001235237.1 | antitermination protein | - |
| PIC30_RS09745 | 2051051..2051764 | + | 714 | WP_000342820.1 | hypothetical protein | - |
| PIC30_RS09770 | 2052489..2052704 | + | 216 | WP_000839572.1 | class II holin family protein | - |
| PIC30_RS09775 | 2052709..2053023 | + | 315 | WP_000193273.1 | YdfR family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ybtP / ybtQ / ybtX / ybtS | 2027149..2076964 | 49815 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T267782 WP_000813254.1 NZ_CP116071:2047948-2048103 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT267782 NZ_CP116071:c2047936-2047878 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
