Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 41851..42120 | Replicon | plasmid pDETEC44 |
| Accession | NZ_CP116069 | ||
| Organism | Escherichia coli strain DETEC-S792 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PID00_RS27460 | Protein ID | WP_001372321.1 |
| Coordinates | 41995..42120 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 41851..41916 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PID00_RS27425 | 37561..38088 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| PID00_RS27430 | 38146..38379 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| PID00_RS27435 | 38440..40463 | + | 2024 | Protein_50 | ParB/RepB/Spo0J family partition protein | - |
| PID00_RS27440 | 40532..40966 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| PID00_RS27445 | 40963..41725 | + | 763 | Protein_52 | plasmid SOS inhibition protein A | - |
| - | 41694..41918 | + | 225 | NuclAT_0 | - | - |
| - | 41694..41918 | + | 225 | NuclAT_0 | - | - |
| - | 41694..41918 | + | 225 | NuclAT_0 | - | - |
| - | 41694..41918 | + | 225 | NuclAT_0 | - | - |
| PID00_RS27450 | 41703..41918 | - | 216 | WP_002430971.1 | hypothetical protein | - |
| - | 41851..41916 | - | 66 | - | - | Antitoxin |
| PID00_RS27455 | 41904..42053 | + | 150 | Protein_54 | plasmid maintenance protein Mok | - |
| PID00_RS27460 | 41995..42120 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PID00_RS27465 | 42439..42735 | - | 297 | Protein_56 | hypothetical protein | - |
| PID00_RS27470 | 43035..43331 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| PID00_RS27475 | 43442..44263 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| PID00_RS27480 | 44560..45150 | - | 591 | WP_000252683.1 | transglycosylase SLT domain-containing protein | - |
| PID00_RS27485 | 45485..45868 | + | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PID00_RS27490 | 46062..46733 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| PID00_RS27495 | 46870..47097 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T267773 WP_001372321.1 NZ_CP116069:41995-42120 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT267773 NZ_CP116069:c41916-41851 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|