Detailed information of TA system TA267773

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 41851..42120
• Replicon: plasmid pDETEC44
• Accession: NZ_CP116069
• Organism: Escherichia coli strain DETEC-S792

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PID00_RS27460
• Protein ID: WP_001372321.1
• Coordinates: 41995..42120 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	41851..41916 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PID00_RS27425	37561..38088	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
PID00_RS27430	38146..38379	+	234	WP_000006003.1	DUF905 family protein	-
PID00_RS27435	38440..40463	+	2024	Protein_50	ParB/RepB/Spo0J family partition protein	-
PID00_RS27440	40532..40966	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
PID00_RS27445	40963..41725	+	763	Protein_52	plasmid SOS inhibition protein A	-
-	41694..41918	+	225	NuclAT_0	-	-
-	41694..41918	+	225	NuclAT_0	-	-
-	41694..41918	+	225	NuclAT_0	-	-
-	41694..41918	+	225	NuclAT_0	-	-
PID00_RS27450	41703..41918	-	216	WP_002430971.1	hypothetical protein	-
-	41851..41916	-	66	-	-	Antitoxin
PID00_RS27455	41904..42053	+	150	Protein_54	plasmid maintenance protein Mok	-
PID00_RS27460	41995..42120	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PID00_RS27465	42439..42735	-	297	Protein_56	hypothetical protein	-
PID00_RS27470	43035..43331	+	297	WP_001272251.1	hypothetical protein	-
PID00_RS27475	43442..44263	+	822	WP_001234445.1	DUF932 domain-containing protein	-
PID00_RS27480	44560..45150	-	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
PID00_RS27485	45485..45868	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PID00_RS27490	46062..46733	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
PID00_RS27495	46870..47097	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T267773 WP_001372321.1 NZ_CP116069:41995-42120 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT267773 NZ_CP116069:c41916-41851 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin