Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 4838481..4839160 | Replicon | chromosome |
| Accession | NZ_CP116067 | ||
| Organism | Escherichia coli strain DETEC-S792 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | PID00_RS23920 | Protein ID | WP_000057523.1 |
| Coordinates | 4838481..4838783 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | PID00_RS23925 | Protein ID | WP_000806442.1 |
| Coordinates | 4838819..4839160 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PID00_RS23900 (4833744) | 4833744..4834964 | - | 1221 | WP_096122201.1 | fosmidomycin MFS transporter | - |
| PID00_RS23905 (4835182) | 4835182..4836834 | + | 1653 | WP_027662559.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| PID00_RS23910 (4836871) | 4836871..4837350 | - | 480 | WP_000186638.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| PID00_RS23915 (4837554) | 4837554..4838348 | - | 795 | WP_000365161.1 | TraB/GumN family protein | - |
| PID00_RS23920 (4838481) | 4838481..4838783 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PID00_RS23925 (4838819) | 4838819..4839160 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| PID00_RS23930 (4839218) | 4839218..4841722 | - | 2505 | WP_096122200.1 | copper-exporting P-type ATPase CopA | - |
| PID00_RS23935 (4841985) | 4841985..4842917 | + | 933 | WP_000883040.1 | glutaminase A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4838481..4848664 | 10183 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T267769 WP_000057523.1 NZ_CP116067:4838481-4838783 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|