Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3184784..3185006 Replicon chromosome
Accession NZ_CP116067
Organism Escherichia coli strain DETEC-S792

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag PID00_RS16025 Protein ID WP_001295224.1
Coordinates 3184784..3184891 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3184940..3185006 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PID00_RS16000 3180318..3180506 - 189 WP_001063314.1 cellulose biosynthesis protein BcsR -
PID00_RS16005 3180779..3182350 + 1572 WP_073569139.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
PID00_RS16010 3182347..3182538 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
PID00_RS16015 3182535..3184214 + 1680 WP_096122216.1 cellulose biosynthesis protein BcsG -
PID00_RS16020 3184301..3184408 - 108 WP_000170735.1 type I toxin-antitoxin system toxin Ldr family protein -
PID00_RS16025 3184784..3184891 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 3184940..3185006 + 67 - - Antitoxin
PID00_RS16030 3185267..3185374 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
PID00_RS16035 3185750..3185857 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
PID00_RS16040 3186333..3187604 + 1272 WP_001318103.1 aromatic amino acid transport family protein -
PID00_RS16045 3187634..3188638 - 1005 WP_000107036.1 dipeptide ABC transporter ATP-binding subunit DppF -
PID00_RS16050 3188635..3189618 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T267762 WP_001295224.1 NZ_CP116067:c3184891-3184784 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT267762 NZ_CP116067:3184940-3185006 [Escherichia coli]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References