Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3184784..3185006 | Replicon | chromosome |
| Accession | NZ_CP116067 | ||
| Organism | Escherichia coli strain DETEC-S792 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | PID00_RS16025 | Protein ID | WP_001295224.1 |
| Coordinates | 3184784..3184891 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3184940..3185006 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PID00_RS16000 | 3180318..3180506 | - | 189 | WP_001063314.1 | cellulose biosynthesis protein BcsR | - |
| PID00_RS16005 | 3180779..3182350 | + | 1572 | WP_073569139.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| PID00_RS16010 | 3182347..3182538 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| PID00_RS16015 | 3182535..3184214 | + | 1680 | WP_096122216.1 | cellulose biosynthesis protein BcsG | - |
| PID00_RS16020 | 3184301..3184408 | - | 108 | WP_000170735.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| PID00_RS16025 | 3184784..3184891 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 3184940..3185006 | + | 67 | - | - | Antitoxin |
| PID00_RS16030 | 3185267..3185374 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| PID00_RS16035 | 3185750..3185857 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| PID00_RS16040 | 3186333..3187604 | + | 1272 | WP_001318103.1 | aromatic amino acid transport family protein | - |
| PID00_RS16045 | 3187634..3188638 | - | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| PID00_RS16050 | 3188635..3189618 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T267762 WP_001295224.1 NZ_CP116067:c3184891-3184784 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT267762 NZ_CP116067:3184940-3185006 [Escherichia coli]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|