Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 802492..802973 Replicon chromosome
Accession NZ_CP116067
Organism Escherichia coli strain DETEC-S792

Toxin (Protein)


Gene name parE_1 Uniprot ID B7MS91
Locus tag PID00_RS04120 Protein ID WP_012601411.1
Coordinates 802683..802973 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID -
Locus tag PID00_RS04115 Protein ID WP_000108762.1
Coordinates 802492..802683 (+) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PID00_RS04065 (797646) 797646..797870 - 225 WP_000015508.1 hypothetical protein -
PID00_RS04070 (797867) 797867..798082 - 216 Protein_801 hypothetical protein -
PID00_RS04075 (798203) 798203..798298 - 96 Protein_802 DUF4406 domain-containing protein -
PID00_RS04080 (798295) 798295..798687 - 393 WP_016237929.1 DUF977 family protein -
PID00_RS04085 (798703) 798703..799428 - 726 WP_062857677.1 DUF1627 domain-containing protein -
PID00_RS04090 (799458) 799458..800198 - 741 WP_000790459.1 ATP-binding protein -
PID00_RS04095 (800205) 800205..801158 - 954 WP_062857679.1 helix-turn-helix domain-containing protein -
PID00_RS04100 (801181) 801181..801606 - 426 WP_000693919.1 toxin YdaT family protein -
PID00_RS04105 (801603) 801603..801866 - 264 WP_001048459.1 helix-turn-helix transcriptional regulator -
PID00_RS04110 (801974) 801974..802474 + 501 WP_000823910.1 helix-turn-helix transcriptional regulator -
PID00_RS04115 (802492) 802492..802683 + 192 WP_000108762.1 hypothetical protein Antitoxin
PID00_RS04120 (802683) 802683..802973 + 291 WP_012601411.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PID00_RS04125 (803248) 803248..803400 + 153 WP_001725971.1 DUF1391 family protein -
PID00_RS04130 (803412) 803412..803750 + 339 WP_000394541.1 hypothetical protein -
PID00_RS04135 (803739) 803739..803933 - 195 WP_001295058.1 hypothetical protein -
PID00_RS04140 (804509) 804509..804697 + 189 WP_000449172.1 cell division inhibition protein DicB -
PID00_RS04145 (804694) 804694..804882 + 189 WP_000199480.1 DUF1482 family protein -
PID00_RS04150 (804977) 804977..807448 + 2472 WP_000048513.1 exonuclease -
PID00_RS04155 (807520) 807520..807771 + 252 WP_000005551.1 excisionase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 756008..907268 151260


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11119.98 Da        Isoelectric Point: 9.9854

>T267750 WP_012601411.1 NZ_CP116067:802683-802973 [Escherichia coli]
MLPILWLPSARDDLRQIVAYIAKENPPAARRLKIRIETSVLSLTEHPYLYPPSERALGLREIVTHPNYIILYRVTASNIE
IVNVVHSRRQYPNKSC

Download         Length: 291 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7075.91 Da        Isoelectric Point: 4.0270

>AT267750 WP_000108762.1 NZ_CP116067:802492-802683 [Escherichia coli]
MSTVLSPIISEFETIEQENSYNEWLRTKVAASLADPRPAIPHDEVMAEMENLIAQIASTNRSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2X1NH18

Antitoxin

Source ID Structure

References