Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4017759..4018413 | Replicon | chromosome |
| Accession | NZ_CP116044 | ||
| Organism | Escherichia coli strain STEC1575 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4NJ21 |
| Locus tag | PHA55_RS19565 | Protein ID | WP_000244772.1 |
| Coordinates | 4017759..4018166 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PHA55_RS19570 | Protein ID | WP_000354046.1 |
| Coordinates | 4018147..4018413 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA55_RS19545 (4013716) | 4013716..4015449 | - | 1734 | WP_271287473.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| PHA55_RS19550 (4015455) | 4015455..4016165 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PHA55_RS19555 (4016190) | 4016190..4017086 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PHA55_RS19560 (4017198) | 4017198..4017719 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| PHA55_RS19565 (4017759) | 4017759..4018166 | - | 408 | WP_000244772.1 | protein YgfX | Toxin |
| PHA55_RS19570 (4018147) | 4018147..4018413 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PHA55_RS19575 (4018656) | 4018656..4019636 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| PHA55_RS19580 (4019713) | 4019713..4020372 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| PHA55_RS19585 (4020536) | 4020536..4020847 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| PHA55_RS19590 (4020892) | 4020892..4022325 | + | 1434 | WP_050864001.1 | 6-phospho-beta-glucosidase BglA | - |
| PHA55_RS19595 (4022382) | 4022382..4023125 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T267718 WP_000244772.1 NZ_CP116044:c4018166-4017759 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XYB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |