Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4494865..4495697 | Replicon | chromosome |
| Accession | NZ_CP116035 | ||
| Organism | Escherichia coli strain FAH | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | PGH49_RS22305 | Protein ID | WP_000854753.1 |
| Coordinates | 4495323..4495697 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NQ68 |
| Locus tag | PGH49_RS22300 | Protein ID | WP_001540478.1 |
| Coordinates | 4494865..4495233 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGH49_RS22265 (4490698) | 4490698..4491378 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| PGH49_RS22270 (4491526) | 4491526..4492203 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| PGH49_RS22275 (4492209) | 4492209..4492442 | + | 234 | WP_001278283.1 | DUF905 family protein | - |
| PGH49_RS22280 (4492532) | 4492532..4493350 | + | 819 | WP_001773857.1 | DUF932 domain-containing protein | - |
| PGH49_RS22285 (4493441) | 4493441..4493926 | + | 486 | WP_000214398.1 | antirestriction protein | - |
| PGH49_RS22290 (4493942) | 4493942..4494418 | + | 477 | WP_001186786.1 | RadC family protein | - |
| PGH49_RS22295 (4494481) | 4494481..4494702 | + | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
| PGH49_RS22300 (4494865) | 4494865..4495233 | + | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PGH49_RS22305 (4495323) | 4495323..4495697 | + | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| PGH49_RS22310 (4495694) | 4495694..4496182 | + | 489 | WP_000777545.1 | DUF5983 family protein | - |
| PGH49_RS22315 (4496194) | 4496194..4496391 | + | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| PGH49_RS22320 (4496488) | 4496488..4497057 | + | 570 | WP_001560692.1 | DUF4942 domain-containing protein | - |
| PGH49_RS22325 (4497806) | 4497806..4499344 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4450968..4507157 | 56189 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T267662 WP_000854753.1 NZ_CP116035:4495323-4495697 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT267662 WP_001540478.1 NZ_CP116035:4494865-4495233 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NQ68 |