Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3607646..3608264 | Replicon | chromosome |
| Accession | NZ_CP116035 | ||
| Organism | Escherichia coli strain FAH | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | PGH49_RS17965 | Protein ID | WP_001291435.1 |
| Coordinates | 3608046..3608264 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | PGH49_RS17960 | Protein ID | WP_000344800.1 |
| Coordinates | 3607646..3608020 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGH49_RS17950 (3602735) | 3602735..3603928 | + | 1194 | WP_001538394.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PGH49_RS17955 (3603951) | 3603951..3607100 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| PGH49_RS17960 (3607646) | 3607646..3608020 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| PGH49_RS17965 (3608046) | 3608046..3608264 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| PGH49_RS17970 (3608437) | 3608437..3608988 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| PGH49_RS17975 (3609104) | 3609104..3609574 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| PGH49_RS17980 (3609738) | 3609738..3611288 | + | 1551 | WP_001538392.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| PGH49_RS17985 (3611330) | 3611330..3611683 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| PGH49_RS17995 (3612062) | 3612062..3612373 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| PGH49_RS18000 (3612404) | 3612404..3612976 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T267653 WP_001291435.1 NZ_CP116035:3608046-3608264 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT267653 WP_000344800.1 NZ_CP116035:3607646-3608020 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |