Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 1714528..1715050 | Replicon | chromosome |
| Accession | NZ_CP116003 | ||
| Organism | Edwardsiella piscicida strain CC1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PED68_RS07900 | Protein ID | WP_069578568.1 |
| Coordinates | 1714528..1714809 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A411H7D8 |
| Locus tag | PED68_RS07905 | Protein ID | WP_069578569.1 |
| Coordinates | 1714799..1715050 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PED68_RS07885 (PED68_07885) | 1709914..1710690 | + | 777 | WP_073382315.1 | hypothetical protein | - |
| PED68_RS07890 (PED68_07890) | 1710683..1712344 | + | 1662 | WP_165362063.1 | terminase | - |
| PED68_RS07895 (PED68_07895) | 1712341..1714455 | + | 2115 | WP_129986139.1 | portal protein | - |
| PED68_RS07900 (PED68_07900) | 1714528..1714809 | - | 282 | WP_069578568.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PED68_RS07905 (PED68_07905) | 1714799..1715050 | - | 252 | WP_069578569.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PED68_RS07910 (PED68_07910) | 1715328..1716329 | + | 1002 | WP_129986135.1 | hypothetical protein | - |
| PED68_RS07915 (PED68_07915) | 1716347..1717585 | + | 1239 | WP_280977425.1 | N4-gp56 family major capsid protein | - |
| PED68_RS07920 (PED68_07920) | 1717644..1718039 | + | 396 | WP_080783446.1 | hypothetical protein | - |
| PED68_RS07925 (PED68_07925) | 1718081..1718524 | + | 444 | WP_080783445.1 | hypothetical protein | - |
| PED68_RS07930 (PED68_07930) | 1718590..1719105 | + | 516 | WP_236721582.1 | hypothetical protein | - |
| PED68_RS07935 (PED68_07935) | 1719105..1719767 | + | 663 | WP_109579934.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1676651..1738121 | 61470 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10738.62 Da Isoelectric Point: 10.6993
>T267591 WP_069578568.1 NZ_CP116003:c1714809-1714528 [Edwardsiella piscicida]
MTYKLSFEKRALKEWKKLAPPIQSQLKKKLIERLENPHIPAARLSGRANRYKIKLRSSGYRLVYEVNDSEIILLVIAIGK
RADNDVYLAADGR
MTYKLSFEKRALKEWKKLAPPIQSQLKKKLIERLENPHIPAARLSGRANRYKIKLRSSGYRLVYEVNDSEIILLVIAIGK
RADNDVYLAADGR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|