Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4567888..4568504 | Replicon | chromosome |
| Accession | NZ_CP115874 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain WYTS.MG41 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PBS85_RS21540 | Protein ID | WP_017382676.1 |
| Coordinates | 4567888..4568259 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | PBS85_RS21545 | Protein ID | WP_015569912.1 |
| Coordinates | 4568262..4568504 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PBS85_RS21525 (PBS85_21525) | 4565388..4566290 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
| PBS85_RS21530 (PBS85_21530) | 4566287..4566922 | + | 636 | WP_003861958.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PBS85_RS21535 (PBS85_21535) | 4566919..4567848 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
| PBS85_RS21540 (PBS85_21540) | 4567888..4568259 | - | 372 | WP_017382676.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PBS85_RS21545 (PBS85_21545) | 4568262..4568504 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| PBS85_RS21550 (PBS85_21550) | 4568703..4569623 | + | 921 | WP_265188251.1 | alpha/beta hydrolase | - |
| PBS85_RS21555 (PBS85_21555) | 4569632..4570573 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
| PBS85_RS21560 (PBS85_21560) | 4570618..4571055 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
| PBS85_RS21565 (PBS85_21565) | 4571052..4571933 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
| PBS85_RS21570 (PBS85_21570) | 4571927..4572526 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
| PBS85_RS21575 (PBS85_21575) | 4572645..4573445 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13737.88 Da Isoelectric Point: 6.4882
>T267456 WP_017382676.1 NZ_CP115874:c4568259-4567888 [Enterobacter hormaechei subsp. steigerwaltii]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|