Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4444206..4444810 | Replicon | chromosome |
| Accession | NZ_CP115874 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain WYTS.MG41 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2J0PXG2 |
| Locus tag | PBS85_RS20985 | Protein ID | WP_071788668.1 |
| Coordinates | 4444625..4444810 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A2G4ZRB5 |
| Locus tag | PBS85_RS20980 | Protein ID | WP_023295606.1 |
| Coordinates | 4444206..4444610 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PBS85_RS20965 (PBS85_20965) | 4439746..4440564 | - | 819 | WP_026094331.1 | helix-turn-helix domain-containing protein | - |
| PBS85_RS20970 (PBS85_20970) | 4440790..4442190 | + | 1401 | WP_023304613.1 | MFS transporter | - |
| PBS85_RS20975 (PBS85_20975) | 4442201..4444150 | + | 1950 | WP_271139033.1 | glycoside hydrolase family 127 protein | - |
| PBS85_RS20980 (PBS85_20980) | 4444206..4444610 | - | 405 | WP_023295606.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PBS85_RS20985 (PBS85_20985) | 4444625..4444810 | - | 186 | WP_071788668.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PBS85_RS20990 (PBS85_20990) | 4445060..4446598 | - | 1539 | WP_006808612.1 | aldehyde dehydrogenase AldB | - |
| PBS85_RS20995 (PBS85_20995) | 4446765..4447649 | + | 885 | WP_015572761.1 | ROK family protein | - |
| PBS85_RS21000 (PBS85_21000) | 4447653..4449491 | - | 1839 | WP_227448262.1 | selenocysteine-specific translation elongation factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6822.05 Da Isoelectric Point: 11.5191
>T267455 WP_071788668.1 NZ_CP115874:c4444810-4444625 [Enterobacter hormaechei subsp. steigerwaltii]
VKSADIIAVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADIIAVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14954.71 Da Isoelectric Point: 4.2329
>AT267455 WP_023295606.1 NZ_CP115874:c4444610-4444206 [Enterobacter hormaechei subsp. steigerwaltii]
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEALPLPGSVEVHLENQPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLP
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEALPLPGSVEVHLENQPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLP
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J0PXG2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2G4ZRB5 |