Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | KacT-ataR/DUF1778(antitoxin) |
| Location | 1682674..1683471 | Replicon | chromosome |
| Accession | NZ_CP115874 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain WYTS.MG41 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | A0A222RDD1 |
| Locus tag | PBS85_RS07845 | Protein ID | WP_032647926.1 |
| Coordinates | 1682950..1683471 (+) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A331QJY7 |
| Locus tag | PBS85_RS07840 | Protein ID | WP_015570876.1 |
| Coordinates | 1682674..1682943 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PBS85_RS07805 (PBS85_07805) | 1678388..1679269 | + | 882 | WP_032670171.1 | DUF6402 family protein | - |
| PBS85_RS07810 (PBS85_07810) | 1679266..1679697 | + | 432 | WP_050594728.1 | DUF6201 family protein | - |
| PBS85_RS07815 (PBS85_07815) | 1679850..1679951 | + | 102 | Protein_1513 | type VI secretion system lipoprotein TssJ | - |
| PBS85_RS07820 (PBS85_07820) | 1680175..1680402 | - | 228 | WP_032670920.1 | YccJ family protein | - |
| PBS85_RS07825 (PBS85_07825) | 1680421..1681017 | - | 597 | WP_006809323.1 | NAD(P)H:quinone oxidoreductase | - |
| PBS85_RS07830 (PBS85_07830) | 1681408..1681578 | + | 171 | WP_001273664.1 | general stress protein | - |
| PBS85_RS07835 (PBS85_07835) | 1681695..1682600 | + | 906 | WP_032653183.1 | DMT family transporter | - |
| PBS85_RS07840 (PBS85_07840) | 1682674..1682943 | + | 270 | WP_015570876.1 | DUF1778 domain-containing protein | Antitoxin |
| PBS85_RS07845 (PBS85_07845) | 1682950..1683471 | + | 522 | WP_032647926.1 | GNAT family N-acetyltransferase | Toxin |
| PBS85_RS07850 (PBS85_07850) | 1683530..1684852 | - | 1323 | WP_032670921.1 | pyrimidine utilization transport protein G | - |
| PBS85_RS07855 (PBS85_07855) | 1684874..1685365 | - | 492 | WP_015570873.1 | pyrimidine utilization flavin reductase protein F | - |
| PBS85_RS07860 (PBS85_07860) | 1685378..1685968 | - | 591 | WP_017693662.1 | malonic semialdehyde reductase | - |
| PBS85_RS07865 (PBS85_07865) | 1685978..1686778 | - | 801 | WP_023296287.1 | pyrimidine utilization protein D | - |
| PBS85_RS07870 (PBS85_07870) | 1686786..1687172 | - | 387 | WP_015570870.1 | pyrimidine utilization protein C | - |
| PBS85_RS07875 (PBS85_07875) | 1687184..1687873 | - | 690 | WP_032670922.1 | pyrimidine utilization protein B | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19451.21 Da Isoelectric Point: 7.4318
>T267445 WP_032647926.1 NZ_CP115874:1682950-1683471 [Enterobacter hormaechei subsp. steigerwaltii]
VANLTIEMLSEGTDYDFGDFDCGEPSLNAFLTEHLIRQHGGRILRGYLLKERDHPRVLGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVTLGRLAVHKELQGNEWGTTLVTHAMRVVYLASQAVGVHGIFVDALNERAKRFYLKLGFIPLAGENSSSLF
FPTQSIERLFEQA
VANLTIEMLSEGTDYDFGDFDCGEPSLNAFLTEHLIRQHGGRILRGYLLKERDHPRVLGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVTLGRLAVHKELQGNEWGTTLVTHAMRVVYLASQAVGVHGIFVDALNERAKRFYLKLGFIPLAGENSSSLF
FPTQSIERLFEQA
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A222RDD1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A331QJY7 |